DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MagR and AT2G36260

DIOPT Version :9

Sequence 1:NP_001259579.1 Gene:MagR / 32513 FlyBaseID:FBgn0026666 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_181168.1 Gene:AT2G36260 / 818198 AraportID:AT2G36260 Length:109 Species:Arabidopsis thaliana


Alignment Length:110 Identity:57/110 - (51%)
Similarity:73/110 - (66%) Gaps:7/110 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 RAALTLTPAAVLRIKTLL--QDKPDMVGLKVGVRQRGCNGLSYTLDYASQKADKLDEEVVQDGVK 85
            :..|.|:..|..||:.||  |.||   .|::.|..:|||||||.|:||.:|. |.||.|.:.|||
plant     3 KQVLALSDTAAARIRQLLQHQQKP---FLRLAVEAKGCNGLSYVLNYAQEKG-KFDEVVEEKGVK 63

  Fly    86 VFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKGTCGCGESFS 130
            :.:|.||.:.::|||||||:.||.|||||.|||.. .|||||||:
plant    64 ILVDPKAVMHVIGTEMDFVDDKLRSEFVFVNPNAT-KCGCGESFT 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MagRNP_001259579.1 TIGR00049 27..130 CDD:272875 55/104 (53%)
AT2G36260NP_181168.1 TIGR00049 8..106 CDD:272875 54/102 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 113 1.000 Domainoid score I2039
eggNOG 1 0.900 - - E1_COG0316
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 119 1.000 Inparanoid score I1992
OMA 1 1.010 - - QHG54692
OrthoDB 1 1.010 - - D1578799at2759
OrthoFinder 1 1.000 - - FOG0000696
OrthoInspector 1 1.000 - - otm3390
orthoMCL 1 0.900 - - OOG6_101081
Panther 1 1.100 - - O PTHR10072
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1490
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.