DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MagR and ISCA1

DIOPT Version :9

Sequence 1:NP_001259579.1 Gene:MagR / 32513 FlyBaseID:FBgn0026666 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_112202.2 Gene:ISCA1 / 81689 HGNCID:28660 Length:129 Species:Homo sapiens


Alignment Length:123 Identity:96/123 - (78%)
Similarity:109/123 - (88%) Gaps:1/123 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ATVRAVKGRKLIPTRAALTLTPAAVLRIKTLLQDKPDMVGLKVGVRQRGCNGLSYTLDYASQKAD 73
            ||||||..|||.||||||||||:||.:||.||:|||:.||:|||||.||||||||||:|...|.|
Human     8 ATVRAVSKRKLQPTRAALTLTPSAVNKIKQLLKDKPEHVGVKVGVRTRGCNGLSYTLEYTKTKGD 72

  Fly    74 KLDEEVVQDGVKVFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKGTCGCGESFSM 131
            . ||||:||||:|||:|||||:|||||||:||.|||||||||||||||||||||||::
Human    73 S-DEEVIQDGVRVFIEKKAQLTLLGTEMDYVEDKLSSEFVFNNPNIKGTCGCGESFNI 129

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MagRNP_001259579.1 TIGR00049 27..130 CDD:272875 80/102 (78%)
ISCA1NP_112202.2 TIGR00049 26..129 CDD:272875 81/103 (79%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165147867
Domainoid 1 1.000 166 1.000 Domainoid score I3904
eggNOG 1 0.900 - - E1_COG0316
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H87862
Inparanoid 1 1.050 193 1.000 Inparanoid score I3855
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54692
OrthoDB 1 1.010 - - D1578799at2759
OrthoFinder 1 1.000 - - FOG0000696
OrthoInspector 1 1.000 - - oto88402
orthoMCL 1 0.900 - - OOG6_101081
Panther 1 1.100 - - LDO PTHR10072
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R617
SonicParanoid 1 1.000 - - X1490
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.