DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MagR and CG13623

DIOPT Version :9

Sequence 1:NP_001259579.1 Gene:MagR / 32513 FlyBaseID:FBgn0026666 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_001262920.1 Gene:CG13623 / 42926 FlyBaseID:FBgn0039205 Length:139 Species:Drosophila melanogaster


Alignment Length:127 Identity:38/127 - (29%)
Similarity:53/127 - (41%) Gaps:16/127 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RKLIPTRAALTLTPA--------AVLRIKTLLQDKPDMVGLKVGVRQRGCNGLSYTLDYASQKAD 73
            |.||..|.|...|.|        :...:|.|.:...|...|:|.|...||:|..|..|...|   
  Fly    15 RNLILMRHATASTSANPELSVQVSESCLKRLREICVDGSFLRVTVEGGGCSGFQYKFDLDKQ--- 76

  Fly    74 KLDEEVVQDG---VKVFIDKKAQLSLLGTEMDFVESKLSSEF-VFNNPNIKGTCGCGESFSM 131
             |:|:..|.|   .||.||..:.....|..:|:....:.:.| :..||..:..|.||.|||:
  Fly    77 -LNEDDRQFGEAEAKVVIDTVSLEYCSGATVDYHSELIRAGFRMVANPLAEQGCSCGSSFSI 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MagRNP_001259579.1 TIGR00049 27..130 CDD:272875 31/114 (27%)
CG13623NP_001262920.1 TIGR00049 36..137 CDD:272875 30/104 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45453478
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0316
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000696
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.