DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MagR and isa1

DIOPT Version :9

Sequence 1:NP_001259579.1 Gene:MagR / 32513 FlyBaseID:FBgn0026666 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_588112.1 Gene:isa1 / 2539409 PomBaseID:SPCC645.03c Length:190 Species:Schizosaccharomyces pombe


Alignment Length:123 Identity:53/123 - (43%)
Similarity:81/123 - (65%) Gaps:4/123 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 TVRAVKGRKLIPTRAALTLTPAAVLRIKTLLQDKPDMVG--LKVGVRQRGCNGLSYTLDYASQKA 72
            |.|.:...:.:|.:..:.|||.||..:|. :|....|.|  |::||:|:||.|.:|:|:|. :|.
pombe    67 TEREIASTRFMPRKNVIKLTPLAVEHLKK-MQSSASMKGKMLRIGVKQKGCAGQAYSLEYI-EKP 129

  Fly    73 DKLDEEVVQDGVKVFIDKKAQLSLLGTEMDFVESKLSSEFVFNNPNIKGTCGCGESFS 130
            ||.||.|.|||:.:.:.::|.|.::|:.||:.:..|.|.|:|:|||:|.|||||||||
pombe   130 DKFDEIVKQDGISIIVARRALLQIIGSVMDYRDDDLQSRFIFSNPNVKSTCGCGESFS 187

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MagRNP_001259579.1 TIGR00049 27..130 CDD:272875 48/104 (46%)
isa1NP_588112.1 TIGR00049 84..188 CDD:272875 50/106 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 101 1.000 Domainoid score I1786
eggNOG 1 0.900 - - E1_COG0316
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I1552
OMA 1 1.010 - - QHG54692
OrthoFinder 1 1.000 - - FOG0000696
OrthoInspector 1 1.000 - - oto100455
orthoMCL 1 0.900 - - OOG6_101081
Panther 1 1.100 - - LDO PTHR10072
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R617
SonicParanoid 1 1.000 - - X1490
TreeFam 1 0.960 - -
1312.860

Return to query results.
Submit another query.