DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MagR and Y54G11A.9

DIOPT Version :9

Sequence 1:NP_001259579.1 Gene:MagR / 32513 FlyBaseID:FBgn0026666 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_001379045.1 Gene:Y54G11A.9 / 175088 WormBaseID:WBGene00013218 Length:134 Species:Caenorhabditis elegans


Alignment Length:137 Identity:35/137 - (25%)
Similarity:65/137 - (47%) Gaps:24/137 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RVVATATVRAVKGRKLIPTRAALTLTPAAVLRIKTLLQDKPDMVGLKVGVRQRGCNGLSYTLDYA 68
            |::|....|  :..::: |...:.:|..|..|:|.::.:..   .|::.|...||:|..|.:   
 Worm     8 RLMACTVTR--QAHRML-TEQEIKVTNKAASRLKEVVDNGE---RLRLEVDGGGCSGFEYKI--- 63

  Fly    69 SQKADKLDEEVVQD---------GVKVFIDKKAQLSLLGTEMDFVESKLSSEF-VFNNPNIKGTC 123
                 :||:::..|         |.::.:|:.:...|.|..:||||..:.|.| :.|||..:..|
 Worm    64 -----RLDKKINNDDLLWKSSENGAEIVVDELSLGFLKGATVDFVEDLMKSSFRIVNNPIAEKGC 123

  Fly   124 GCGESFS 130
            .||.||:
 Worm   124 SCGSSFA 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MagRNP_001259579.1 TIGR00049 27..130 CDD:272875 30/112 (27%)
Y54G11A.9NP_001379045.1 IscA 27..129 CDD:223393 29/112 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0316
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54692
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000696
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.