DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MagR and ISCA2

DIOPT Version :9

Sequence 1:NP_001259579.1 Gene:MagR / 32513 FlyBaseID:FBgn0026666 Length:131 Species:Drosophila melanogaster
Sequence 2:NP_919255.2 Gene:ISCA2 / 122961 HGNCID:19857 Length:154 Species:Homo sapiens


Alignment Length:147 Identity:44/147 - (29%)
Similarity:69/147 - (46%) Gaps:24/147 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VATATVRAV----KGRKLIPT------RAALTLTPAA---VLR-----IKTLLQDKPDMVGLKVG 52
            :..||.|||    :||.|..:      |.|.:.:|.|   .:|     ::.||:.......|::.
Human     9 LTAATQRAVTPWPRGRLLTASLGPQARREASSSSPEAGEGQIRLTDSCVQRLLEITEGSEFLRLQ 73

  Fly    53 VRQRGCNGLSY--TLDYASQKADKLDEEVVQDGVKVFIDKKAQLSLLGTEMDFVESKLSSEF-VF 114
            |...||:|..|  :||......|::.|   |.|.:|.:|..:...:.|.::||.:..:.|.| |.
Human    74 VEGGGCSGFQYKFSLDTVINPDDRVFE---QGGARVVVDSDSLAFVKGAQVDFSQELIRSSFQVL 135

  Fly   115 NNPNIKGTCGCGESFSM 131
            |||..:..|.||.|||:
Human   136 NNPQAQQGCSCGSSFSI 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MagRNP_001259579.1 TIGR00049 27..130 CDD:272875 32/113 (28%)
ISCA2NP_919255.2 Fe-S_biosyn 7..153 CDD:294282 44/147 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 29..49 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0316
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54692
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000696
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.