DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12379 and AT5G27280

DIOPT Version :9

Sequence 1:NP_573061.2 Gene:CG12379 / 32512 FlyBaseID:FBgn0030676 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_198080.1 Gene:AT5G27280 / 832786 AraportID:AT5G27280 Length:212 Species:Arabidopsis thaliana


Alignment Length:77 Identity:27/77 - (35%)
Similarity:39/77 - (50%) Gaps:2/77 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 SKPVDDADKTVATN--SIPLAKLEAKMQLIYTCKVCQTRNMKTISKLAYQRGVVIVTCEGCSNHH 130
            |.|......||:|.  |:.......:|::.:||.||..|..:.|:..||..|.|.|.|.||:..|
plant    95 SLPAKTDTDTVSTFPWSLFTKSPRRRMRVAFTCNVCGQRTTRAINPHAYTDGTVFVQCCGCNVFH 159

  Fly   131 LIADNLNWFTDL 142
            .:.||||.|.::
plant   160 KLVDNLNLFHEV 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12379NP_573061.2 zf-DNL 93..158 CDD:282966 20/50 (40%)
AT5G27280NP_198080.1 zf-DNL 123..>172 CDD:368321 20/49 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3277
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1626191at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm3573
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR20922
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.880

Return to query results.
Submit another query.