DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12379 and dnlz

DIOPT Version :9

Sequence 1:NP_573061.2 Gene:CG12379 / 32512 FlyBaseID:FBgn0030676 Length:174 Species:Drosophila melanogaster
Sequence 2:NP_001074117.1 Gene:dnlz / 791166 ZFINID:ZDB-GENE-070112-1482 Length:183 Species:Danio rerio


Alignment Length:158 Identity:70/158 - (44%)
Similarity:90/158 - (56%) Gaps:35/158 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RGALLTSSRRTQIDALNSPQLQLQVHHFATKTQTAVFSSSNNYTCI----------CRSIHCSKP 70
            |||.:.|...||...|      .:|.|   :...:.|::|...:.:          |||.     
Zfish    18 RGAGVLSVPETQRVTL------ARVRH---EESNSAFTNSTLRSDVGHDTGLGLSFCRSF----- 68

  Fly    71 VDDADKTVATNSIPLAKLEA-KMQLIYTCKVCQTRNMKTISKLAYQRGVVIVTCEGCSNHHLIAD 134
                    :|.:|  .:|:: ...|:||||||.||:||.||||||.:|||||||.||.|||:|||
Zfish    69 --------STEAI--GQLQSTHYHLVYTCKVCSTRSMKKISKLAYHKGVVIVTCPGCKNHHVIAD 123

  Fly   135 NLNWFTDLDGKRNIEEILAEKGEKVVRL 162
            ||.||:||:||||||||||.|||.|.|:
Zfish   124 NLKWFSDLEGKRNIEEILAAKGESVRRV 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12379NP_573061.2 zf-DNL 93..158 CDD:282966 50/64 (78%)
dnlzNP_001074117.1 zf-DNL 82..147 CDD:282966 50/64 (78%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..183
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170575716
Domainoid 1 1.000 115 1.000 Domainoid score I5995
eggNOG 1 0.900 - - E1_KOG3277
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1626191at2759
OrthoFinder 1 1.000 - - FOG0004081
OrthoInspector 1 1.000 - - oto38891
orthoMCL 1 0.900 - - OOG6_103202
Panther 1 1.100 - - LDO PTHR20922
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1685
SonicParanoid 1 1.000 - - X3356
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1413.740

Return to query results.
Submit another query.