DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12379 and dnlz

DIOPT Version :9

Sequence 1:NP_573061.2 Gene:CG12379 / 32512 FlyBaseID:FBgn0030676 Length:174 Species:Drosophila melanogaster
Sequence 2:XP_002935266.1 Gene:dnlz / 779561 XenbaseID:XB-GENE-940250 Length:185 Species:Xenopus tropicalis


Alignment Length:111 Identity:62/111 - (55%)
Similarity:72/111 - (64%) Gaps:7/111 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 ICRSIHCSKPVDDADKTVATNSIPLAKLEAKMQLIYTCKVCQTRNMKTISKLAYQRGVVIVTCEG 125
            :|.::..|:.....|.|..|.|      .....||||||||.||:.|||||.||.:|||||.|.|
 Frog    54 VCGTLPPSQHALRLDCTAPTAS------SGHYHLIYTCKVCSTRSNKTISKGAYHKGVVIVKCPG 112

  Fly   126 CSNHHLIADNLNWFTDLDGKRNIEEILAEKGEKVVRLT-DGNCEFL 170
            |.|||:|||||.||:||:||||||||||.|||:|.||. |...|.|
 Frog   113 CKNHHIIADNLGWFSDLEGKRNIEEILAAKGERVQRLVGDDAVEIL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12379NP_573061.2 zf-DNL 93..158 CDD:282966 49/64 (77%)
dnlzXP_002935266.1 zf-DNL 80..145 CDD:368321 49/64 (77%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 110 1.000 Domainoid score I6261
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1626191at2759
OrthoFinder 1 1.000 - - FOG0004081
OrthoInspector 1 1.000 - - oto104411
Panther 1 1.100 - - LDO PTHR20922
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1685
SonicParanoid 1 1.000 - - X3356
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
88.050

Return to query results.
Submit another query.