DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HUWE1 and HECTD3

DIOPT Version :9

Sequence 1:NP_001285288.1 Gene:HUWE1 / 32510 FlyBaseID:FBgn0030674 Length:5151 Species:Drosophila melanogaster
Sequence 2:NP_078878.3 Gene:HECTD3 / 79654 HGNCID:26117 Length:861 Species:Homo sapiens


Alignment Length:466 Identity:110/466 - (23%)
Similarity:196/466 - (42%) Gaps:97/466 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly  4723 AQLRQDRQKFLQFAEKHRTVLNQILRQSPTHLSDGPFAVLVDHTRILDFDVKRKYFQTELERLDE 4787
            ::::|.:| ||..:.:...::.|.||.|.:  |...|             :.|.|....|..   
Human   437 SEIKQVKQ-FLLLSRQRPGLVAQCLRDSES--SKPSF-------------MPRLYINRRLAM--- 482

  Fly  4788 GIRREEHTVSVRRVTVFEDS-FRVLYR-LGPEE---------WKNRFYIVFEDE---EG-QDAGG 4837
                 ||.....|....::: |..:|. |.|.:         |..|:...:|.:   || .|.||
Human   483 -----EHRACPSRDPACKNAVFTQVYEGLKPSDKYEKPLDYRWPMRYDQWWECKFIAEGIIDQGG 542

  Fly  4838 LLREWYVIISREIFNPMYALFCVSPGD---------------------RVTYMINPSSHANPNHL 4881
            ..|:....:|.|:        |.|..|                     |..|:.|||.    ...
Human   543 GFRDSLADMSEEL--------CPSSADTPVPLPFFVRTANQGNGTGEARDMYVPNPSC----RDF 595

  Fly  4882 SYFKFVGRVIAKAVHDNKLLECYFTRSFYKHILGKQVKHT-DMESQDYEFYKGLDYLMKNDIST- 4944
            :.::::|:::..|:...:.|........:|.:.|::|..: |..:.|....|.|:.:...|..| 
Human   596 AKYEWIGQLMGAALRGKEFLVLALPGFVWKQLSGEEVSWSKDFPAVDSVLVKLLEVMEGMDKETF 660

  Fly  4945 ---LGYELTFSTEVQEFGVTQIRDLKPNGRDTAVTEENKFEYVQLVCQLKMSGSIRQQLDAFLEG 5006
               .|.||||:|.:.:   .|:.:|.|.|....|...::..::|||.:.::..| ::|:.|...|
Human   661 EFKFGKELTFTTVLSD---QQVVELIPGGAGIVVGYGDRSRFIQLVQKARLEES-KEQVAAMQAG 721

  Fly  5007 FYDIIPKHLISIFNEQELELLISGLPDIDIEDLKANTEYHKYTSKSAQIQWFWRALRSFDQADRA 5071
            ...::|:.::.:...||||..:.|.|::.::.|:..|.:..:....:::|:||.||.:|...||:
Human   722 LLKVVPQAVLDLLTWQELEKKVCGDPEVTVDALRKLTRFEDFEPSDSRVQYFWEALNNFTNEDRS 786

  Fly  5072 KFLQFVTGTSKVPLQGFGSLEGMNGIQKFQIHRDD---RSTDRLPCAHTCFNQLDLPMYKSYDKL 5133
            :||:||||.|::|             .:..|:.|.   .:||.||.:.||.:.|.||.|.|....
Human   787 RFLRFVTGRSRLP-------------ARIYIYPDKLGYETTDALPESSTCSSTLFLPHYASAKVC 838

  Fly  5134 RSCLLKAIHEC 5144
            ...|..|.:.|
Human   839 EEKLRYAAYNC 849

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HUWE1NP_001285288.1 DUF908 90..326 CDD:283630
DUF913 621..989 CDD:283642
UBA_like_SF 1467..1506 CDD:304366
WWE 1756..1828 CDD:128922
40S_SA_C 3575..3651 CDD:292740
DUF4414 3675..3779 CDD:291075
HECTc 4796..5149 CDD:238033 95/393 (24%)
HECTc 4820..5148 CDD:214523 89/358 (25%)
HECTD3NP_078878.3 APC10-HECTD3 238..371 CDD:176487
HECT 579..845 CDD:366212 74/286 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.