DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HUWE1 and Herc4

DIOPT Version :9

Sequence 1:NP_001285288.1 Gene:HUWE1 / 32510 FlyBaseID:FBgn0030674 Length:5151 Species:Drosophila melanogaster
Sequence 2:NP_084390.1 Gene:Herc4 / 67345 MGIID:1914595 Length:1057 Species:Mus musculus


Alignment Length:453 Identity:117/453 - (25%)
Similarity:214/453 - (47%) Gaps:42/453 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  4721 HEAQ-LRQDRQKFLQFAEKHRTVLNQILRQSPTHLSDGPFAVLVDHTRILDFDVKRKYFQTEL-- 4782
            ||.| |...|..::.:.::....::  :....|.|:|.|..:.. :..:.|...|....||:.  
Mouse   619 HEVQELIDIRNDYINWVQQQAYGVD--VSHGVTELADIPVTICT-YPFVFDAQAKTTLLQTDAVL 680

  Fly  4783 ---ERLDEGIRREEHT--------------VSVRRVTVFEDSFRVLYRLGPEEWKNRFYIVFEDE 4830
               ..:|:..|:...:              :.|||..:..|:..||.:....::|....::|..|
Mouse   681 QMQMAIDQAHRQNVSSLFLPVIESVNPCLILVVRRENIVGDAMEVLRKTKNIDYKKPLKVIFVGE 745

  Fly  4831 EGQDAGGLLREWYVIISREIFNPMYALFCVSPGDRVTYMINPSSHANPNHLSYFKFVGRVIAKAV 4895
            :..||||:.:|::::|.||:.:|.|.:|......|:.:..:.:...:    ..|..:|.:...|:
Mouse   746 DAVDAGGVRKEFFLLIMRELLDPKYGMFRYYEDSRLIWFSDKTFEDS----DLFHLIGVICGLAI 806

  Fly  4896 HDNKLLECYFTRSFYKHILGKQVKHTD----MESQDYEFYKGLDYLMKNDISTLGYELTFSTEVQ 4956
            ::..:::.:|..:.||.:|.::....|    |.:......:.||| .::||... :.|.|:..|:
Mouse   807 YNFTIVDLHFPLALYKKLLKRKPSLDDLKELMPAVGRSMQQLLDY-PEDDIEET-FCLNFTITVE 869

  Fly  4957 EFGVTQIRDLKPNGRDTAVTEENKFEYVQLVCQLKMSGSIRQQLDAFLEGFYDIIPKHLISIFNE 5021
            .||.|::::|..||.||||..:|:.|:|........:.|:....|||..||:.:....::.:|..
Mouse   870 NFGATEVKELVLNGADTAVNRQNRQEFVDAYVDYIFNKSVASLFDAFHAGFHKVCGGKVLLLFQP 934

  Fly  5022 QELELLISGLPDIDIEDLKANTEYH-KYTSKSAQIQWFWRALRSFDQADRAKFLQFVTGTSKVPL 5085
            .||:.::.|..:.|.::|:.||||. :|.:....|:.||..........:.:||.|:||:.::|:
Mouse   935 NELQAMVIGNTNYDWKELEKNTEYKGEYWADHPTIKIFWEVFHELPLEKKKQFLLFLTGSDRIPI 999

  Fly  5086 QGFGSLEGMNGIQKFQIHRDDRSTDRLPCAHTCFNQLDLPMYKSYDKLRSCLLKAIHECSEGF 5148
            .|..||       |..|.........||.:|||||.||||.|...:.||..|::|| :.:|||
Mouse  1000 LGMKSL-------KLVIQSTGGGESYLPVSHTCFNLLDLPKYTEKETLRCKLIQAI-DHNEGF 1054

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HUWE1NP_001285288.1 DUF908 90..326 CDD:283630
DUF913 621..989 CDD:283642
UBA_like_SF 1467..1506 CDD:304366
WWE 1756..1828 CDD:128922
40S_SA_C 3575..3651 CDD:292740
DUF4414 3675..3779 CDD:291075
HECTc 4796..5149 CDD:238033 102/358 (28%)
HECTc 4820..5148 CDD:214523 94/332 (28%)
Herc4NP_084390.1 RCC1 1 1..51
RCC1 3..49 CDD:278826
RCC1 2 52..101
RCC1 52..99 CDD:278826
RCC1 3 102..154
RCC1 102..152 CDD:278826
RCC1 4 156..207
RCC1 157..205 CDD:278826
RCC1 5 208..259
RCC1 208..257 CDD:278826
RCC1 260..308 CDD:278826
RCC1 6 261..311
RCC1 7 313..366
RCC1 313..>343 CDD:278826
HECTc 709..1055 CDD:238033 102/360 (28%)
HECTc 735..1054 CDD:214523 94/332 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.