DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HUWE1 and ASCC1

DIOPT Version :9

Sequence 1:NP_001285288.1 Gene:HUWE1 / 32510 FlyBaseID:FBgn0030674 Length:5151 Species:Drosophila melanogaster
Sequence 2:NP_001185728.1 Gene:ASCC1 / 51008 HGNCID:24268 Length:400 Species:Homo sapiens


Alignment Length:308 Identity:58/308 - (18%)
Similarity:107/308 - (34%) Gaps:76/308 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   900 STPRTQQAGGVVGSGAGATGTPAAASQAVKVVTPPEREAIP---LIDYILNVMKFIEAIFSNSPN 961
            |.|:..|.|.:|.:|....|..:|.:: :.|:....|...|   .:.:.||.::..|...     
Human   121 SIPKPGQDGEIVITGQHRNGVISARTR-IDVLLDTFRRKQPFTHFLAFFLNEVEVQEGFL----- 179

  Fly   962 GDHCREFVL------HGGLKPILQLLSLPNLPVDSPVSTTSQAVANVCKAILSQAQETKVLDVA- 1019
              ..:|.||      ||....|.|.....:|.:...|..:.:.:...|: :|.|.:|..:.|:: 
Human   180 --RFQEEVLAKCSMDHGVDSSIFQNPKKLHLTIGMLVLLSEEEIQQTCE-MLQQCKEEFINDISG 241

  Fly  1020 ----------LKQLADIVAQLKPLIKHFTFPGGSVLLAELVCCQRLEDGFANAEYTPILHNMSFV 1074
                      ::.:.|....:..|........||..|.|||  .|:.:.|.             .
Human   242 GKPLEVEMAGIEYMNDDPGMVDVLYAKVHMKDGSNRLQELV--DRVLERFQ-------------A 291

  Fly  1075 HGYVVMLVHLCRNASNDMRTILLK------RWGVNRETGVQLLQQLVQLYISLVWESTILL---- 1129
            .|.:|...:..:..:..|.|:..|      |:.:....|..:.::........:.:|..||    
Human   292 SGLIVKEWNSVKLHATVMNTLFRKDPNAEGRYNLYTAEGKYIFKERESFDGRNILKSFALLPRLE 356

  Fly  1130 ---------NLC----SDEPTQHPDLIWDEIAAQMSAAAGTADPLTEA 1164
                     |||    ||.|..         |:|::...|.:|..:::
Human   357 YNDAISAHCNLCLPGSSDSPAS---------ASQVAGITGVSDAYSQS 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HUWE1NP_001285288.1 DUF908 90..326 CDD:283630
DUF913 621..989 CDD:283642 22/97 (23%)
UBA_like_SF 1467..1506 CDD:304366
WWE 1756..1828 CDD:128922
40S_SA_C 3575..3651 CDD:292740
DUF4414 3675..3779 CDD:291075
HECTc 4796..5149 CDD:238033
HECTc 4820..5148 CDD:214523
ASCC1NP_001185728.1 Required for interaction with ASCC3. /evidence=ECO:0000269|PubMed:29997253 1..53
vigilin_like_KH 99..148 CDD:239087 8/27 (30%)
PLN00108 157..370 CDD:177724 41/235 (17%)
AKAP7_NLS 161..349 CDD:287446 34/210 (16%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.