DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HUWE1 and CG4238

DIOPT Version :9

Sequence 1:NP_001285288.1 Gene:HUWE1 / 32510 FlyBaseID:FBgn0030674 Length:5151 Species:Drosophila melanogaster
Sequence 2:NP_001259896.1 Gene:CG4238 / 33377 FlyBaseID:FBgn0031384 Length:977 Species:Drosophila melanogaster


Alignment Length:397 Identity:131/397 - (32%)
Similarity:211/397 - (53%) Gaps:29/397 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  4771 FDVKRKYFQTELERLDEGIRREEHTVSVRRVTVFEDSFRVLYRLGPEEWKNRFYIVFEDEEGQDA 4835
            |..|:.:|..|:.:.......|:..:.|:|..:.|.|.:.:......:|...|.:.|:.|:|.|.
  Fly   590 FKDKQDFFYHEVRKFHASYYHEKMALKVQREKILESSMKAVKGFSVSDWCGNFEVTFQGEQGIDW 654

  Fly  4836 GGLLREWYVIISREIFNPMYALFCVSPGDRVTYMINPSSHANPNH--LSYFKFVGRVIAKAVHDN 4898
            |||.|||:.::...:|:....|||.. .|:...:::|:. ..|.|  |.:|:|.|:::.|.:.::
  Fly   655 GGLRREWFELVCSALFDARGGLFCTF-HDKHQALVHPNP-TRPAHLKLKHFEFAGKMVGKCLFES 717

  Fly  4899 -------KLLECYFTRSFYKHILGKQVKHTDMESQDYEFY-KGLDYLMKNDI-STLGYELTFSTE 4954
                   :|:...|:|||...::|.:|.:...|..|.:.| ..:.|::..|: :|...||.|..|
  Fly   718 ALGGTYRQLVRARFSRSFLAQLIGLRVHYKYFEQDDPDLYLSKIKYILDTDLDATDTLELYFVEE 782

  Fly  4955 VQEFGVTQIR---DLKPNGRDTAVTEENKFEYVQLVCQLKMSGSIRQQLDAFLEGFYDIIPKHLI 5016
            :.:....|:.   :|.|||..|.||...|.:|:..:.|.::..:::.::|:||:|...|||.:|:
  Fly   783 MYDSSSGQLSKTIELIPNGAKTRVTNATKNQYLDALAQQRLCNNVKDEVDSFLKGLNSIIPDNLL 847

  Fly  5017 SIFNEQELELLISGLPDIDIEDLKANTEYHKYTSKSAQ----IQWFWRALRSFDQADRAKFLQFV 5077
            |||:|.|||||:.|..:..|.|.||   :|.....||:    :.|||..:.:|.|.:.|:.|||.
  Fly   848 SIFDENELELLMCGTGEYSISDFKA---HHIANGNSAEFRRVLAWFWAGVSNFSQTEMARLLQFT 909

  Fly  5078 TGTSKVPLQGFGSLEGMNGIQKFQIHRDDRSTDRLPCAHTCFNQLDLPMYKSYDKLRSCLLKAIH 5142
            ||.|::|..||..|.     .:|||.... :...||.||||||||.||.|:||::....||.||.
  Fly   910 TGCSQLPPGGFQELN-----PQFQITAAP-TFGNLPTAHTCFNQLCLPDYESYEQFEKSLLLAIS 968

  Fly  5143 ECSEGFG 5149
            |.|||||
  Fly   969 EGSEGFG 975

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HUWE1NP_001285288.1 DUF908 90..326 CDD:283630
DUF913 621..989 CDD:283642
UBA_like_SF 1467..1506 CDD:304366
WWE 1756..1828 CDD:128922
40S_SA_C 3575..3651 CDD:292740
DUF4414 3675..3779 CDD:291075
HECTc 4796..5149 CDD:238033 124/370 (34%)
HECTc 4820..5148 CDD:214523 118/345 (34%)
CG4238NP_001259896.1 IG_FLMN 238..336 CDD:214720
Filamin 238..336 CDD:279024
HECTc 615..975 CDD:238033 124/370 (34%)
HECTc 642..974 CDD:214523 118/342 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446947
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D140374at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11254
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.