DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HUWE1 and Magix

DIOPT Version :9

Sequence 1:NP_001285288.1 Gene:HUWE1 / 32510 FlyBaseID:FBgn0030674 Length:5151 Species:Drosophila melanogaster
Sequence 2:NP_001014131.1 Gene:Magix / 317379 RGDID:1549729 Length:326 Species:Rattus norvegicus


Alignment Length:261 Identity:62/261 - (23%)
Similarity:84/261 - (32%) Gaps:69/261 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  3174 LPH-LIKELKAAHQQRKQEEAARQSTTPASGSNASATSSSTTSVVGTAAPTATSSIASGLLANAV 3237
            ||| .:.|.:..| ||...:..|....|...:.||..|         ..|.||            
  Rat    82 LPHATLVEHRPQH-QRSDTQGPRMEPLPVIQNKASYAS---------RLPQAT------------ 124

  Fly  3238 SAGSGSSSLVVPPVAASAT--GGTRRS-SIPVLISSTL--GPSSASSATSATG-----NGATSDA 3292
              |..|..||..|.....|  ||...| ::|:.:...|  ||:.......|..     ||.::..
  Rat   125 --GRFSVELVRGPAGFGLTLSGGRNVSGNVPLAVCGLLKDGPAQRCGHLQAGDLVLYINGQSTRG 187

  Fly  3293 TT--------TTGGP-----TRNFSSVDSNVSSET----QTTTRPPRQRGGLRQQSQLPFNIYAE 3340
            .|        .||||     .:....::.:.|.|.    |.|.|.|..|||...:|:...:....
  Rat   188 LTHAQAVEWIRTGGPRLCLVLQRPQEMNGSRSKEVGGGHQKTDRIPDPRGGRMMESRGTISPVHH 252

  Fly  3341 IDLTNEQDSEGDRSTSTTTGTAADGAESQSQHNSSSTAAQVAVPQHQRHPPVP---LLPSSGRPS 3402
            ...|  :...|....|..||.....||..::            ....|.|..|   |:||..|.|
  Rat   253 RPKT--RTGPGPSPESVATGHVVRAAEHPAE------------DLEDRIPGSPGPWLVPSEDRLS 303

  Fly  3403 R 3403
            |
  Rat   304 R 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HUWE1NP_001285288.1 DUF908 90..326 CDD:283630
DUF913 621..989 CDD:283642
UBA_like_SF 1467..1506 CDD:304366
WWE 1756..1828 CDD:128922
40S_SA_C 3575..3651 CDD:292740
DUF4414 3675..3779 CDD:291075
HECTc 4796..5149 CDD:238033
HECTc 4820..5148 CDD:214523
MagixNP_001014131.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
PDZ_signaling 127..209 CDD:238492 20/81 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 214..267 12/54 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.