DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HUWE1 and Smurf2

DIOPT Version :9

Sequence 1:NP_001285288.1 Gene:HUWE1 / 32510 FlyBaseID:FBgn0030674 Length:5151 Species:Drosophila melanogaster
Sequence 2:NP_001100531.1 Gene:Smurf2 / 303614 RGDID:1310067 Length:748 Species:Rattus norvegicus


Alignment Length:463 Identity:181/463 - (39%)
Similarity:258/463 - (55%) Gaps:50/463 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  4696 EPRMQDASTNTPLVTNPSTSTAMSAHEAQLRQDRQKFLQFAEKHRTVLNQILRQSPTHLSDGPFA 4760
            :||:   |.|..||.|         .:.||:..:|:             |::...|         
  Rat   327 DPRL---SANLHLVLN---------RQNQLKDQQQQ-------------QVVSLCP--------- 357

  Fly  4761 VLVDHTRILDFDVKRKYFQTELERLDEGIRREE----H-TVSVRRVTVFEDSFRVLYRLGPEE-W 4819
               |.|..|.....::....:|:.|.:.:.:::    | .:.|.|..:||:|:|.:.::.|:: |
  Rat   358 ---DDTECLTVPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRPKDLW 419

  Fly  4820 KNRFYIVFEDEEGQDAGGLLREWYVIISREIFNPMYALFCVSPGDRVTYMINPSSHANPNHLSYF 4884
            | |..|.|..|||.|.||:.|||..::|.|:.||.|.||..|..|..|..|||.|..||.|||||
  Rat   420 K-RLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAVNPEHLSYF 483

  Fly  4885 KFVGRVIAKAVHDNKLLECYFTRSFYKHILGKQVKHTDMESQDYEFYKGLDYLMKNDISTLGYEL 4949
            .||||::..||.....::..||..|||.:|||.:...|||..|.:.:..|.::::|||:.: .:.
  Rat   484 HFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKSITLDDMELVDPDLHNSLVWILENDITGV-LDH 547

  Fly  4950 TFSTEVQEFGVTQIRDLKPNGRDTAVTEENKFEYVQLVCQLKMSGSIRQQLDAFLEGFYDIIPKH 5014
            ||..|...:|.....:|||||:...||||||.|||:|....:....|..|..|..:||.::||:|
  Rat   548 TFCVEHNAYGEIIQHELKPNGKSIPVTEENKKEYVRLYVNWRFLRGIEAQFLALQKGFNEVIPQH 612

  Fly  5015 LISIFNEQELELLISGLPDIDIEDLKANTEYHKYTSKSAQIQWFWRALRSFDQADRAKFLQFVTG 5079
            |:..|:|:||||:|.||..||:.|.||||.....|..|..::|||:|:..||:..||:.||||||
  Rat   613 LLKTFDEKELELIICGLGKIDVSDWKANTRLKHCTPDSNVVKWFWKAVELFDEERRARLLQFVTG 677

  Fly  5080 TSKVPLQGFGSLEGMNGIQKFQIHRDDRSTDRLPCAHTCFNQLDLPMYKSYDKLRSCLLKAIHE- 5143
            :|:||||||.:|:|..|.:.|.||:.|..|:.||.||||||::|:|.|:||:||...||.||.| 
  Rat   678 SSRVPLQGFKALQGAAGPRLFTIHQIDACTNNLPKAHTCFNRIDIPPYESYEKLYEKLLTAIEET 742

  Fly  5144 CSEGFGFA 5151
            |    |||
  Rat   743 C----GFA 746

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HUWE1NP_001285288.1 DUF908 90..326 CDD:283630
DUF913 621..989 CDD:283642
UBA_like_SF 1467..1506 CDD:304366
WWE 1756..1828 CDD:128922
40S_SA_C 3575..3651 CDD:292740
DUF4414 3675..3779 CDD:291075
HECTc 4796..5149 CDD:238033 160/354 (45%)
HECTc 4820..5148 CDD:214523 152/328 (46%)
Smurf2NP_001100531.1 C2_Smurf-like 13..137 CDD:176028
PRP40 155..>236 CDD:227435
WW 159..188 CDD:395320
WW 252..283 CDD:197736
WW 298..330 CDD:197736 1/2 (50%)
HECTc 393..745 CDD:238033 160/357 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.