DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HUWE1 and HERC4

DIOPT Version :9

Sequence 1:NP_001285288.1 Gene:HUWE1 / 32510 FlyBaseID:FBgn0030674 Length:5151 Species:Drosophila melanogaster
Sequence 2:XP_011537894.1 Gene:HERC4 / 26091 HGNCID:24521 Length:1081 Species:Homo sapiens


Alignment Length:455 Identity:117/455 - (25%)
Similarity:217/455 - (47%) Gaps:46/455 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  4721 HEAQ----LRQDRQKFLQFAEKHRTVLNQILRQSPTHLSDGPFAVLVDHTRILDFDVKRKYFQTE 4781
            ||.|    :|.|...::|     :......:....|.|:|.|..:.. :..:.|...|....||:
Human   643 HEVQELIDIRNDYINWVQ-----QQAYGMDVNHGLTELADIPVTICT-YPFVFDAQAKTTLLQTD 701

  Fly  4782 L-----ERLDEGIRREEHT--------------VSVRRVTVFEDSFRVLYRLGPEEWKNRFYIVF 4827
            .     ..:|:..|:...:              :.|||..:..|:..||.:....::|....::|
Human   702 AVLQMQMAIDQAHRQNVSSLFLPVIESVNPCLILVVRRENIVGDAMEVLRKTKNIDYKKPLKVIF 766

  Fly  4828 EDEEGQDAGGLLREWYVIISREIFNPMYALFCVSPGDRVTYMINPSSHANPNHLSYFKFVGRVIA 4892
            ..|:..||||:.:|::::|.||:.:|.|.:|......|:.:..:.:...:    ..|..:|.:..
Human   767 VGEDAVDAGGVRKEFFLLIMRELLDPKYGMFRYYEDSRLIWFSDKTFEDS----DLFHLIGVICG 827

  Fly  4893 KAVHDNKLLECYFTRSFYKHILGKQVKHTDMESQDYEFYKGLDYLM---KNDISTLGYELTFSTE 4954
            .|:::..:::.:|..:.||.:|.|:....|::....:..:.:..|:   ::||... :.|.|:..
Human   828 LAIYNCTIVDLHFPLALYKKLLKKKPSLDDLKELMPDVGRSMQQLLDYPEDDIEET-FCLNFTIT 891

  Fly  4955 VQEFGVTQIRDLKPNGRDTAVTEENKFEYVQLVCQLKMSGSIRQQLDAFLEGFYDIIPKHLISIF 5019
            |:.||.|::::|..||.||||.::|:.|:|........:.|:....|||..||:.:....::.:|
Human   892 VENFGATEVKELVLNGADTAVNKQNRQEFVDAYVDYIFNKSVASLFDAFHAGFHKVCGGKVLLLF 956

  Fly  5020 NEQELELLISGLPDIDIEDLKANTEYH-KYTSKSAQIQWFWRALRSFDQADRAKFLQFVTGTSKV 5083
            ...||:.::.|..:.|.::|:.||||. :|.::...|:.||..........:.:||.|:||:.::
Human   957 QPNELQAMVIGNTNYDWKELEKNTEYKGEYWAEHPTIKIFWEVFHELPLEKKKQFLLFLTGSDRI 1021

  Fly  5084 PLQGFGSLEGMNGIQKFQIHRDDRSTDRLPCAHTCFNQLDLPMYKSYDKLRSCLLKAIHECSEGF 5148
            |:.|..||       |..|.......:.||.:|||||.||||.|...:.|||.|::|| :.:|||
Human  1022 PILGMKSL-------KLVIQSTGGGEEYLPVSHTCFNLLDLPKYTEKETLRSKLIQAI-DHNEGF 1078

  Fly  5149  5148
            Human  1079  1078

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HUWE1NP_001285288.1 DUF908 90..326 CDD:283630
DUF913 621..989 CDD:283642
UBA_like_SF 1467..1506 CDD:304366
WWE 1756..1828 CDD:128922
40S_SA_C 3575..3651 CDD:292740
DUF4414 3675..3779 CDD:291075
HECTc 4796..5149 CDD:238033 101/357 (28%)
HECTc 4820..5148 CDD:214523 93/331 (28%)
HERC4XP_011537894.1 RCC1 2..368 CDD:332518
HECTc 733..1079 CDD:238033 101/359 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.