DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HUWE1 and WWTR1

DIOPT Version :9

Sequence 1:NP_001285288.1 Gene:HUWE1 / 32510 FlyBaseID:FBgn0030674 Length:5151 Species:Drosophila melanogaster
Sequence 2:NP_001161750.1 Gene:WWTR1 / 25937 HGNCID:24042 Length:400 Species:Homo sapiens


Alignment Length:324 Identity:65/324 - (20%)
Similarity:107/324 - (33%) Gaps:117/324 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly  3545 PPPPPPPSDTTPLVHAEDDLWPGTVVSAGTREESSAPAVATESTEAVNESNQPEPT-------PE 3602
            |||.|||..  .::|...||                   .|:.....|....|:|:       ||
Human     7 PPPLPPPGQ--QVIHVTQDL-------------------DTDLEALFNSVMNPKPSSWRKKILPE 50

  Fly  3603 S--------SESTSPNPQAPSAEPTPLEPGAAVDASVGAQTPATTEEAASTAGASGTTA------ 3653
            |        |.|...:..:....|.|...|.|  ..|.:.:...:.:..:.|||:|:.|      
Human    51 SFFKEPDSGSHSRQSSTDSSGGHPGPRLAGGA--QHVRSHSSPASLQLGTGAGAAGSPAQQHAHL 113

  Fly  3654 -----TITDMSPEVRAALGDLEVPEGVDPSFLA-------------ALPSEMREEVIQ--EHLRM 3698
                 .:||          :|.:|.|.:.:|.|             ....:.|:.:.|  .|:.:
Human   114 RQQSYDVTD----------ELPLPPGWEMTFTATGQRYFLNHIEKITTWQDPRKAMNQPLNHMNL 168

  Fly  3699 ----------QRIRQRAQQNAI-------QIAHDSLVEVN------PEFLAALPLNI-----QSE 3735
                      ||....:|.|.:       |:|..:|.:.|      |..|.::|..:     |.:
Human   169 HPAVSSTPVPQRSMAVSQPNLVMNHQHQQQMAPSTLSQQNHPTQNPPAGLMSMPNALTTQQQQQQ 233

  Fly  3736 VLMQQRIEQQRQAAQTANPEDPVDTAAFFQNLPENLRQAILTDMEESQIASL-----PPELAAE 3794
            .|..|||:.:|:..:....|.....||..:.||          ||...:|.:     ||.:..:
Human   234 KLRLQRIQMERERIRMRQEELMRQEAALCRQLP----------MEAETLAPVQAAVNPPTMTPD 287

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HUWE1NP_001285288.1 DUF908 90..326 CDD:283630
DUF913 621..989 CDD:283642
UBA_like_SF 1467..1506 CDD:304366
WWE 1756..1828 CDD:128922
40S_SA_C 3575..3651 CDD:292740 17/90 (19%)
DUF4414 3675..3779 CDD:291075 27/146 (18%)
HECTc 4796..5149 CDD:238033
HECTc 4820..5148 CDD:214523
WWTR1NP_001161750.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 52..117 12/66 (18%)
WW 125..156 CDD:197736 4/30 (13%)
Required for interaction with PALS1. /evidence=ECO:0000269|PubMed:21145499 222..400 17/76 (22%)
PDZ-binding 394..400
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.