DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HUWE1 and Ube3b

DIOPT Version :9

Sequence 1:NP_001285288.1 Gene:HUWE1 / 32510 FlyBaseID:FBgn0030674 Length:5151 Species:Drosophila melanogaster
Sequence 2:NP_473434.2 Gene:Ube3b / 117146 MGIID:1891295 Length:1070 Species:Mus musculus


Alignment Length:467 Identity:147/467 - (31%)
Similarity:219/467 - (46%) Gaps:61/467 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  4725 LRQDRQKFLQFAE--KHRTVLNQILRQSPTHLSDGPFAVLVDH-TRILDFDVKRKYFQTELERLD 4786
            ||:|.:..:.|.|  |.|.....:|:..| |        :|.| .|:|.|   |.....|.|:|.
Mouse   619 LRRDLKPGVLFQELDKDRRRAQLVLQHIP-H--------VVPHKNRVLLF---RNMVIKEKEKLG 671

  Fly  4787 --EGIRREEHT--VSVRRVTVFEDSFRVLYRLGPEEWKNRFYIVF-----EDEEGQDAGGLLREW 4842
              |......|.  :::||..:.||.:..|.:|.....|....:.|     .||.|.|..|:.:|:
Mouse   672 LVETSSASPHVTHITIRRSRMLEDGYEQLRQLSQHAMKGVIRVKFVNDLGVDEAGIDQDGVFKEF 736

  Fly  4843 YVIISREIFNPMYALFCVSPGDRVTYMINPSSHANPNHLSYFKFVGRVIAKAVHDNKLLECYFTR 4907
            ...|.:.:|:|...||..:.||...|. :|:|:.:.|:|..|:|||:::.|||::..:::..|..
Mouse   737 LEEIIKRVFDPALNLFKTTSGDERLYP-SPTSYIHENYLQLFEFVGKMLGKAVYEGIVVDVPFAS 800

  Fly  4908 SFYKHILGKQVKHT-------DMESQDYEFYKGLDYLMK--NDISTLGYELTFSTEVQEFGVTQI 4963
            .|...:||..  |:       ::.|.|.||||.|..:.:  .||:.||..|::..:|  .|....
Mouse   801 FFLSQMLGHH--HSVFYSSVDELPSLDSEFYKNLTSIKRYDGDIADLGLTLSYDEDV--MGQLVC 861

  Fly  4964 RDLKPNGRDTAVTEENKFEYVQLVCQLKMSGSIRQQLDAFLEGFYDIIPKHLISIFNEQELELLI 5028
            .:|.|.|:...||:|||..|:.|:...:|...|:.|..|.:.||..||....|.:|:..||:.||
Mouse   862 HELVPGGKTIPVTDENKISYIHLMAHFRMHTQIKNQTAALISGFRSIIKPEWIRMFSTPELQRLI 926

  Fly  5029 SG-LPDIDIEDLKANTEYH-KYTSKSAQIQWFWRALRS-FDQADRAKFLQFVTGTSKVPLQGFGS 5090
            || ..:||:||||.:|.|: .:......|.|.|..|.| |...:||.||:|||..|:.||.||..
Mouse   927 SGDNAEIDLEDLKKHTVYYGGFHGSHRVIIWLWDILASDFTPEERAMFLKFVTSCSRPPLLGFAY 991

  Fly  5091 LEGMNGIQKFQIHRDDRSTD-------------------RLPCAHTCFNQLDLPMYKSYDKLRSC 5136
            |:....|:..::..|..:.|                   |||.:.||||.|.||.|.....||..
Mouse   992 LKPPFSIRCVEVSDDQDTGDTLGSVLRGFFTIRKREPGGRLPTSSTCFNLLKLPNYSKKSVLREK 1056

  Fly  5137 LLKAIHECSEGF 5148
            |..|| ..:.||
Mouse  1057 LRYAI-SMNTGF 1067

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HUWE1NP_001285288.1 DUF908 90..326 CDD:283630
DUF913 621..989 CDD:283642
UBA_like_SF 1467..1506 CDD:304366
WWE 1756..1828 CDD:128922
40S_SA_C 3575..3651 CDD:292740
DUF4414 3675..3779 CDD:291075
HECTc 4796..5149 CDD:238033 126/389 (32%)
HECTc 4820..5148 CDD:214523 118/363 (33%)
Ube3bNP_473434.2 HECTc 684..1068 CDD:238033 126/390 (32%)
HECTc 709..1067 CDD:214523 118/363 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5021
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.