DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment HPRT1 and Pgm1

DIOPT Version :10

Sequence 1:NP_000185.1 Gene:HPRT1 / 3251 HGNCID:5157 Length:218 Species:Homo sapiens
Sequence 2:NP_524675.1 Gene:Pgm1 / 44010 FlyBaseID:FBgn0003076 Length:560 Species:Drosophila melanogaster


Alignment Length:125 Identity:30/125 - (24%)
Similarity:50/125 - (40%) Gaps:32/125 - (25%)


- Green bases have known domain annotations that are detailed below.


Human    71 GYKFFADLLDYIKALNRNSDRSIPMTVDFIRLKSYCNDQSTGDIKVIGGDDLSTLTGKNVLIVED 135
            |..|..:::|.:    .|..|.:....||.:||.:.:.::||....:..|.::.:||        
  Fly   178 GKPFTVEVIDSV----ANYVRHMEEIFDFAKLKDFVSGKATGKPLKMRIDAMNGVTG-------- 230

Human   136 IIDTGKTMQTLLSLVRQ-YNPKMVKVASLLVKRTPRSVGYKPDFVGFEIPDKFVVGYALD 194
                        |.||: :..::....|.:|..||     .|||.|.. ||..:. ||.|
  Fly   231 ------------SYVREIFLNRLGATESSVVHTTP-----LPDFGGLH-PDPNLT-YAKD 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
HPRT1NP_000185.1 PRTases_typeI 8..218 CDD:444823 30/125 (24%)
Pgm1NP_524675.1 PGM1 6..560 CDD:100087 30/125 (24%)

Return to query results.
Submit another query.