DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15601 and CG12768

DIOPT Version :9

Sequence 1:NP_573058.1 Gene:CG15601 / 32509 FlyBaseID:FBgn0030673 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001262229.1 Gene:CG12768 / 40513 FlyBaseID:FBgn0037206 Length:429 Species:Drosophila melanogaster


Alignment Length:224 Identity:50/224 - (22%)
Similarity:90/224 - (40%) Gaps:33/224 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 LEAYRRQPCLYNTLLDSYKNRVSREEAYGAIIRSLKIPQL------TVSDIKLKIKSVRTVYSKE 73
            :|..|..|.|::..|..||....|        :::|..:|      ....::....|:|.::.:|
  Fly    14 IELVRLNPILWDCRLPHYKRSDKR--------KAIKWNELGRLFNVNGERVQRTFTSLREIFRRE 70

  Fly    74 LRIWMREKELGRTYEPKLFWFRLADSFLRSVSLSHCKRQGKNNSS--SAQLTTIKSDETSKLLCT 136
            |.   .||.||.|.....:.:..|.:||:.|......|:...:.|  ||.:.|..|:..:..:..
  Fly    71 LN---HEKMLGTTRFKSKWEYYDAMAFLKEVIRERKSRERIKHGSLDSAPVATGSSNNNNNCVSR 132

  Fly   137 AAADITMSEDALEE-------EDAEVNGEPEECPLEESRPTASICKDDSTLCLADQP----QQEH 190
            .:::...|..||:|       :....|.:|:..|  |.:.:..:.....:|.|:..|    ||..
  Fly   133 NSSNNNSSSAALDEYQYFAPSDPNNPNNQPQLQP--EPKSSLPVTIPSLSLTLSQLPVALQQQAQ 195

  Fly   191 YSQGCSSSQQLPHTMAQRKSKYITSLDSA 219
            :.|.......:..|..|::| ..|||.:|
  Fly   196 HLQALQLQPDVTLTSLQKQS-LPTSLTNA 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15601NP_573058.1 MADF_DNA_bdg 14..101 CDD:287510 20/91 (22%)
CG12768NP_001262229.1 MADF 12..100 CDD:214738 23/96 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2D0D8
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.