DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG15601 and CG3386

DIOPT Version :9

Sequence 1:NP_573058.1 Gene:CG15601 / 32509 FlyBaseID:FBgn0030673 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001261216.1 Gene:CG3386 / 38081 FlyBaseID:FBgn0035152 Length:288 Species:Drosophila melanogaster


Alignment Length:301 Identity:69/301 - (22%)
Similarity:114/301 - (37%) Gaps:73/301 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 EFLEAYRRQPCLYNTLLDSYKNRVSREEAYGAIIRSLK--IPQLTVSDIKLKIKSVRTVYSKELR 75
            |||..|:..|.|::....:|:|:..|..||..:.|.|:  .|..|.:::..:|...||.|.:|..
  Fly    19 EFLALYQGMPELWDVHHLNYRNKELRNRAYELLERKLREIQPNATRTEVGRRINIFRTNYRREQM 83

  Fly    76 IWMREKELG---RTYEPKLFWFRLADSFLRSVSLSHCKRQGKNNSSSAQLTTIKSD----ETSKL 133
            ..:::||||   ...:|.|:::......|...:..|..|:|:...........|.|    :...|
  Fly    84 RILKQKELGLHSDLCKPTLWFYDYMGFLLTQETFQHRTRKGRGGRQKQDFRREKDDKYPLKNPDL 148

  Fly   134 LCTAAADITMSED----------ALEEEDAEVNG------EPEE--C----------PLEESRPT 170
            ...:..|..:.:|          |.:.|:..:..      ||||  |          .||...||
  Fly   149 NTESVCDWPIKDDNAFNYQSEPTAPQSEEGSLLSPKLEIIEPEEGQCEVKEENSLGNSLETKEPT 213

  Fly   171 ASICKDDSTLCLADQPQQEHYSQGCSSSQQLPHTMAQRKSKYITSLDSAGEDDLIIFGQSIASQL 235
            :||..|         |:.|   :|.:..|                |..:.|    :..:|.|.|.
  Fly   214 SSIQTD---------PENE---RGTAPMQ----------------LSESSE----VLARSWAIQY 246

  Fly   236 RTIPDSYSRSVAKLRIQQVLFEAETGQFQSTEVNSTQLQNT 276
            ..:..: .|.:|:..|..:|||...|..:   ||..:.|:|
  Fly   247 EEMSPT-QRILARKAIADILFEGCMGNLR---VNRGEQQST 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG15601NP_573058.1 MADF_DNA_bdg 14..101 CDD:287510 25/91 (27%)
CG3386NP_001261216.1 MADF_DNA_bdg 20..111 CDD:287510 25/90 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45468893
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR21505
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.