DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8134 and F8a1

DIOPT Version :9

Sequence 1:NP_001285283.1 Gene:CG8134 / 32507 FlyBaseID:FBgn0030671 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001102793.1 Gene:F8a1 / 501661 RGDID:1566014 Length:381 Species:Rattus norvegicus


Alignment Length:406 Identity:90/406 - (22%)
Similarity:127/406 - (31%) Gaps:161/406 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SLGGG---GSSSGAPSTAPGHEHHQLEQYQYPKNLIEQYLRASSKIKKFERAGFFKRF--APSVV 67
            |||||   ||.:|                    :.:.:|.:.|:|:|        |||  .|:|.
  Rat     8 SLGGGSWPGSEAG--------------------DFLARYRQVSNKLK--------KRFLRKPNVA 44

  Fly    68 DVQADFQRLAYSFEESGIQQYAAMCHIGYAKCESYGGAPQRESEAYLRAARSFL----------- 121
            :....|.:||..........|||.|.:..|:|:........|:.|...|||.||           
  Rat    45 EAGEQFAQLARELRAQECLPYAAWCQLAVARCQQALFHGPGEALALTEAARLFLRQECDARQRLG 109

  Fly   122 --AAHNE-----------SGRLHLR-----------------TRHSGFREGAVHCYHRAA----- 151
              ||:.|           :.||||.                 .|..|....|...:.|||     
  Rat   110 CPAAYGEPLQAAASALGAAVRLHLELGQPAAAAALCLELAAALRAVGQPAAAAGHFQRAAQLHLP 174

  Fly   152 -----------DRAVDGCVFKA-------AILRELKQLQR--------------QLDST------ 178
                       |.|  .|...|       |:...:::|.|              ||.|.      
  Rat   175 LMPLAALQALGDAA--SCQLLARDYTGALAVFTRMQRLAREHGGHPVQQPELPQQLPSVPQPSLP 237

  Fly   179 ---------SSFASPTHQIHDLEISAETSGQRGDFRSALQHYDDIVDNVYERRGARMYGELLRRV 234
                     |:...|....|.....|::.|..|.|                       .::|.|.
  Rat   238 GPQPRPVLGSTLPLPLPPDHAPGSVAQSPGTLGAF-----------------------ADVLVRC 279

  Fly   235 EVLRLLLLVHLNLPPARQSPAHIKLIEYYYNLAQFESLPCSADDGGSAERPGAFVPEQQQYALAE 299
            ||.|:|||:.|..|||:..|.|.:.:|.|         ...|.||...:..|. :||:....|..
  Rat   280 EVSRVLLLLLLQPPPAKLLPEHAQTLEKY---------SWEAFDGHGQDSSGQ-LPEELFLLLQS 334

  Fly   300 ITCAWVERKMCDLKHL 315
            :..|..|:....:|.|
  Rat   335 LVMAAHEKDTEGIKKL 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8134NP_001285283.1 None
F8a1NP_001102793.1 Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:Q00558 34..36 1/9 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..260 6/46 (13%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351788
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28IE5
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52481
OrthoDB 1 1.010 - - D1141704at2759
OrthoFinder 1 1.000 - - FOG0007113
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107020
Panther 1 1.100 - - LDO PTHR16797
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.850

Return to query results.
Submit another query.