DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8134 and F8A2

DIOPT Version :9

Sequence 1:NP_001285283.1 Gene:CG8134 / 32507 FlyBaseID:FBgn0030671 Length:345 Species:Drosophila melanogaster
Sequence 2:NP_001007524.1 Gene:F8A2 / 474383 HGNCID:31849 Length:371 Species:Homo sapiens


Alignment Length:397 Identity:90/397 - (22%)
Similarity:125/397 - (31%) Gaps:154/397 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LGGGGSSSGAPSTAPGHEHHQLEQYQYPKNLIEQYLRASSKIKKFERAGFFKRF--APSVVDVQA 71
            |||||:       .||.|         ..:.:.:|...|:|:|        |||  .|:|.:...
Human     8 LGGGGA-------GPGPE---------AGDFLARYRLVSNKLK--------KRFLRKPNVAEAGE 48

  Fly    72 DFQRLAYSFEESGIQQYAAMCHIGYAKCESYGGAPQRESEAYLRAARSFL-------------AA 123
            .|.:|...........|||.|.:..|:|:........|:.|...|||.||             ||
Human    49 QFGQLGRELRAQECLPYAAWCQLAVARCQQALFHGPGEALALTEAARLFLRQERDARQRLVCPAA 113

  Fly   124 HNE-----------SGRLHLRTRHSGFREGAVHCYHRAADRAVDGCVFKAAILRELKQ------- 170
            :.|           :.||||.....            ||..|:  |:..||.||:|.|       
Human   114 YGEPLQAAASALGAAVRLHLELGQP------------AAAAAL--CLELAAALRDLGQPAAAAGH 164

  Fly   171 ----LQRQL----------------------DSTSSFASPT--------HQIHDLE--------- 192
                .|.||                      |.|.:.|..|        |..|.::         
Human   165 FQRAAQLQLPQLPLAALQALGEAASCQLLARDYTGALAVFTRMQRLAREHGSHPVQSLPPPPPPA 229

  Fly   193 --------------ISAETSGQRGDFRSALQHYDDIVDNVYERRGARMYGELLRRVEVLRLLLLV 243
                          :....||......:||..:.|:                |.|.||.|:|||:
Human   230 PQPGPGATPALPAALLPPNSGSAAPSPAALGAFSDV----------------LVRCEVSRVLLLL 278

  Fly   244 HLNLPPARQSPAHIKLIEYYYNLAQFESLPCSADDGGSAERPGAFVPEQQQYALAEITCAWVERK 308
            .|..|||:..|.|.:.:|.|         ...|.|....|..|. :||:....|..:..|..|:.
Human   279 LLQPPPAKLLPEHAQTLEKY---------SWEAFDSHGQESSGQ-LPEELFLLLQSLVMATHEKD 333

  Fly   309 MCDLKHL 315
            ...:|.|
Human   334 TEAIKSL 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8134NP_001285283.1 None
F8A2NP_001007524.1 Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:Q00558 34..36 1/9 (11%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..250 2/36 (6%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157825
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28IE5
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG52481
OrthoDB 1 1.010 - - D1141704at2759
OrthoFinder 1 1.000 - - FOG0007113
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR16797
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R6996
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.940

Return to query results.
Submit another query.