DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8134 and f8a

DIOPT Version :9

Sequence 1:NP_001285283.1 Gene:CG8134 / 32507 FlyBaseID:FBgn0030671 Length:345 Species:Drosophila melanogaster
Sequence 2:XP_005160094.1 Gene:f8a / 450058 ZFINID:ZDB-GENE-041010-181 Length:317 Species:Danio rerio


Alignment Length:307 Identity:81/307 - (26%)
Similarity:131/307 - (42%) Gaps:55/307 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 NLIEQYLRASSKIKKFERAGFFKRF--APSVVDVQADFQRLAYSFEESGIQQYAAMCHIGYAKCE 100
            :.:.:|...|:|:|        |||  .|:|.:....|.:||...::....||||.|::..|:||
Zfish     6 DFLMRYRAVSNKLK--------KRFLRKPNVAEASEQFGQLAKELKQQDCPQYAAFCNLAMARCE 62

  Fly   101 -SYGGAPQRESEAYLRAARSFLAAHNESGRLHLRTRHSGFRE---GAVHCYHRAADRAVD--GCV 159
             :...|| .|:.|...|||.|||:..|:..|    |..||.|   .|::||..|....::  ..|
Zfish    63 QTLFNAP-GEALALTDAARLFLASEQETRAL----RAPGFDENMQAAMNCYSFAIKVYIEMNQPV 122

  Fly   160 FKAAILRE----LKQLQRQLDSTSSF--------ASPTHQIHDLEISAETSGQRGDFRSALQHYD 212
            ..|::..|    ||::.|..::...|        ..|...:..|...|.......|:..||....
Zfish   123 MAASLSLELGNALKEMNRPGEAIIHFQRAAELQIQMPIEALLSLWEMASCKILTRDYDGALAVLS 187

  Fly   213 DIVDNVYERRGARMYG---------ELLRRVEVLRLLLLVHLNLPPARQSPAHIKLIEYYYNLAQ 268
            : :.::.:.||.::.|         :::.:.|:.|:|||:.|..||.:..|.|.:.:|.|    .
Zfish   188 E-MQHMCQERGLQLPGTNTPVGAFMDIIAKCEISRVLLLMLLEPPPQKLLPEHAQTLERY----A 247

  Fly   269 FESLPCSADDGGSAERPGAFVPEQQQYALAEITCAWVERKMCDLKHL 315
            :||.     |..|...   |:||.....|..:..|..|:....||.|
Zfish   248 WESF-----DSHSQVN---FLPENVFLLLQSVVMACQEKDTESLKAL 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8134NP_001285283.1 None
f8aXP_005160094.1 SNAP 16..>182 CDD:305195 49/178 (28%)
TPR repeat 27..64 CDD:276937 12/36 (33%)
TPR repeat 68..118 CDD:276937 20/54 (37%)
TPR repeat 121..157 CDD:276937 7/35 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170593615
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28IE5
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I5382
OMA 1 1.010 - - QHG52481
OrthoDB 1 1.010 - - D1141704at2759
OrthoFinder 1 1.000 - - FOG0007113
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_107020
Panther 1 1.100 - - LDO PTHR16797
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
109.770

Return to query results.
Submit another query.