DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pis and CLS

DIOPT Version :10

Sequence 1:NP_573055.1 Gene:Pis / 32506 FlyBaseID:FBgn0030670 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_567273.1 Gene:CLS / 825825 AraportID:AT4G04870 Length:341 Species:Arabidopsis thaliana


Alignment Length:68 Identity:22/68 - (32%)
Similarity:34/68 - (50%) Gaps:1/68 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FIFVPNLIGYARIVLALIAFWFMSTNYVISGWC-YVTSALLDAVDGQAARAFNQSTRFGAMLDQL 73
            |:.|||:|..||:|...:.:|.:|.....|.:. ...|...|.:||..||....::..|:.||.|
plant   141 FVNVPNMISMARLVSGPVLWWMISNEMYSSAFLGLAVSGASDWLDGYVARRMKINSVVGSYLDPL 205

  Fly    74 TDR 76
            .|:
plant   206 ADK 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PisNP_573055.1 CDP-OH_P_transf 13..>103 CDD:460049 21/65 (32%)
CLSNP_567273.1 PLN02794 1..341 CDD:178391 22/68 (32%)

Return to query results.
Submit another query.