DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pis and PGPS2

DIOPT Version :10

Sequence 1:NP_573055.1 Gene:Pis / 32506 FlyBaseID:FBgn0030670 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_191063.1 Gene:PGPS2 / 824669 AraportID:AT3G55030 Length:233 Species:Arabidopsis thaliana


Alignment Length:83 Identity:22/83 - (26%)
Similarity:37/83 - (44%) Gaps:10/83 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 IFVPNLIGYARIVLALIAFWFMSTNYVISGW-------CYVTSALLDAVDGQAARAFNQSTRFGA 68
            |.:|.::...|:....|   .::|.||...|       .::.:|:.|.:||..||.....:.|||
plant    41 ITLPTVLTLGRVAAVPI---LVATFYVDCWWGRTATTSIFIAAAITDWLDGYIARKMRLGSEFGA 102

  Fly    69 MLDQLTDRCGTTGLLVTL 86
            .||.:.|:......|:.|
plant   103 FLDPVADKLMVAATLILL 120

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PisNP_573055.1 CDP-OH_P_transf 13..>103 CDD:460049 21/81 (26%)
PGPS2NP_191063.1 PLN02558 33..232 CDD:166199 22/83 (27%)

Return to query results.
Submit another query.