DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pis and cdipt

DIOPT Version :9

Sequence 1:NP_573055.1 Gene:Pis / 32506 FlyBaseID:FBgn0030670 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001072374.1 Gene:cdipt / 779827 XenbaseID:XB-GENE-1008885 Length:218 Species:Xenopus tropicalis


Alignment Length:215 Identity:108/215 - (50%)
Similarity:150/215 - (69%) Gaps:9/215 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DNVFIFVPNLIGYARIVLALIAFWFMSTNYVISGWCYVTSALLDAVDGQAARAFNQSTRFGAMLD 71
            :|:|:||||||||||||.|.:||:||.|:.|::...|:.|.||||.||.|||..||.|:||||||
 Frog     4 ENIFLFVPNLIGYARIVFAFVAFYFMPTSPVLASTFYLLSGLLDAFDGHAARLLNQGTKFGAMLD 68

  Fly    72 QLTDRCGTTGLLVTLAYFYPRYMFWFQLSIAIDVACHWLFMQTSVVVGRSSHK-VN--DNFIMRL 133
            .|||||.|..|||.|:..||.|...||||:::|:|.|||.:.:|::.|..||| :|  .|.::||
 Frog    69 MLTDRCATMCLLVNLSLLYPSYTLLFQLSMSLDIASHWLHLHSSILKGSESHKTINLAGNPVLRL 133

  Fly   134 YY-QKDILTFMCCVNELFYVCLYLLHFTYGPLIF----GA-SLFKILAFLTGPFAVLKALISVMH 192
            || .:.:|.|||..|||||..|||||||.||.:.    || .||:::.:|..|.:::|:|||::|
 Frog   134 YYTSRPVLFFMCAGNELFYCMLYLLHFTEGPSVILGPVGAIGLFRLIVWLCCPISLIKSLISLIH 198

  Fly   193 AYVAGIDLAAVDVRERQERR 212
            ...|..::|::|..||.:::
 Frog   199 LVTASSNIASLDCAERSKKK 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PisNP_573055.1 CDP-OH_P_transf 13..75 CDD:307284 39/61 (64%)
cdiptNP_001072374.1 CDP-OH_P_transf 10..72 CDD:376450 39/61 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 122 1.000 Domainoid score I5606
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7159
Inparanoid 1 1.050 210 1.000 Inparanoid score I3574
OMA 1 1.010 - - QHG53925
OrthoDB 1 1.010 - - D1615564at2759
OrthoFinder 1 1.000 - - FOG0004202
OrthoInspector 1 1.000 - - oto102347
Panther 1 1.100 - - LDO PTHR15362
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1704
SonicParanoid 1 1.000 - - X2946
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.