DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pis and Crls1

DIOPT Version :9

Sequence 1:NP_573055.1 Gene:Pis / 32506 FlyBaseID:FBgn0030670 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001014280.1 Gene:Crls1 / 366196 RGDID:1311037 Length:302 Species:Rattus norvegicus


Alignment Length:106 Identity:27/106 - (25%)
Similarity:47/106 - (44%) Gaps:25/106 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VPNLIGYARIVLA-LIAFWFMSTNYVISGWCYVTSALLDAVDGQAARAF-NQSTRFGAMLDQLTD 75
            :|||:...||.|| ::.:..:..::.::...:..:.|.|.:||..||.: ||.:..|:.||.|.|
  Rat   109 IPNLLSMTRIGLAPVLGYLILEEDFNVALGVFALAGLTDLLDGFIARNWANQKSALGSALDPLAD 173

  Fly    76 RCGTTGLLVTLAY-----------------------FYPRY 93
            :...:.|.::|.|                       ||.||
  Rat   174 KVLISILYISLTYADLIPVPLTYMIISRDVMLIAAVFYVRY 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PisNP_573055.1 CDP-OH_P_transf 13..75 CDD:307284 19/63 (30%)
Crls1NP_001014280.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..84
PgsA 107..297 CDD:223632 27/106 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0558
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.