DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pis and Crls1

DIOPT Version :10

Sequence 1:NP_573055.1 Gene:Pis / 32506 FlyBaseID:FBgn0030670 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_001014280.1 Gene:Crls1 / 366196 RGDID:1311037 Length:302 Species:Rattus norvegicus


Alignment Length:106 Identity:27/106 - (25%)
Similarity:47/106 - (44%) Gaps:25/106 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 VPNLIGYARIVLA-LIAFWFMSTNYVISGWCYVTSALLDAVDGQAARAF-NQSTRFGAMLDQLTD 75
            :|||:...||.|| ::.:..:..::.::...:..:.|.|.:||..||.: ||.:..|:.||.|.|
  Rat   109 IPNLLSMTRIGLAPVLGYLILEEDFNVALGVFALAGLTDLLDGFIARNWANQKSALGSALDPLAD 173

  Fly    76 RCGTTGLLVTLAY-----------------------FYPRY 93
            :...:.|.::|.|                       ||.||
  Rat   174 KVLISILYISLTYADLIPVPLTYMIISRDVMLIAAVFYVRY 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PisNP_573055.1 CDP-OH_P_transf 13..>103 CDD:460049 27/106 (25%)
Crls1NP_001014280.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 65..84
PLN02794 <92..288 CDD:178391 27/106 (25%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.