DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pis and Cdipt

DIOPT Version :9

Sequence 1:NP_573055.1 Gene:Pis / 32506 FlyBaseID:FBgn0030670 Length:224 Species:Drosophila melanogaster
Sequence 2:NP_620254.1 Gene:Cdipt / 192260 RGDID:620576 Length:213 Species:Rattus norvegicus


Alignment Length:210 Identity:107/210 - (50%)
Similarity:144/210 - (68%) Gaps:4/210 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 DNVFIFVPNLIGYARIVLALIAFWFMSTNYVISGWCYVTSALLDAVDGQAARAFNQSTRFGAMLD 71
            :|:|:||||||||||||.|:|:|:||......:...|:.|.||||.||.||||.||.||||||||
  Rat     4 ENIFLFVPNLIGYARIVFAIISFYFMPCCPFTASSFYLLSGLLDAFDGHAARALNQGTRFGAMLD 68

  Fly    72 QLTDRCGTTGLLVTLAYFYPRYMFWFQLSIAIDVACHWLFMQTSVVVGRSSHKVND---NFIMRL 133
            .|||||.|..|||.||..|||....||||:::|||.|||.:.:|||.|..|||:.|   |.::|:
  Rat    69 MLTDRCATMCLLVNLALLYPRATLLFQLSMSLDVASHWLHLHSSVVRGSESHKMIDLSGNPVLRI 133

  Fly   134 YY-QKDILTFMCCVNELFYVCLYLLHFTYGPLIFGASLFKILAFLTGPFAVLKALISVMHAYVAG 197
            || .:..|..:|..|||||..|||.:|:.|||:....||::..::|.|.|:||::|||:|...|.
  Rat   134 YYTSRPALFTLCAGNELFYCLLYLFNFSEGPLVGSVGLFRMGLWITAPIALLKSIISVIHLVTAA 198

  Fly   198 IDLAAVDVRERQERR 212
            .::||:|..:|.:::
  Rat   199 RNMAALDAADRAKKK 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PisNP_573055.1 CDP-OH_P_transf 13..75 CDD:307284 39/61 (64%)
CdiptNP_620254.1 CDP-OH_P_transf 10..72 CDD:395847 39/61 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166345230
Domainoid 1 1.000 123 1.000 Domainoid score I5489
eggNOG 1 0.900 - - E1_COG0558
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7159
Inparanoid 1 1.050 207 1.000 Inparanoid score I3632
OMA 1 1.010 - - QHG53925
OrthoDB 1 1.010 - - D1615564at2759
OrthoFinder 1 1.000 - - FOG0004202
OrthoInspector 1 1.000 - - oto95608
orthoMCL 1 0.900 - - OOG6_102569
Panther 1 1.100 - - LDO PTHR15362
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2946
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.