DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pis and CDIPT

DIOPT Version :9

Sequence 1:NP_573055.1 Gene:Pis / 32506 FlyBaseID:FBgn0030670 Length:224 Species:Drosophila melanogaster
Sequence 2:XP_005255095.1 Gene:CDIPT / 10423 HGNCID:1769 Length:237 Species:Homo sapiens


Alignment Length:153 Identity:74/153 - (48%)
Similarity:103/153 - (67%) Gaps:4/153 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 TRFGAMLDQLTDRCGTTGLLVTLAYFYPRYMFWFQLSIAIDVACHWLFMQTSVVVGRSSHKVND- 127
            ||||||||.|||||.|..|||.||..||....:||:|:::|||.|||.:.:|||.|..|||:.| 
Human    85 TRFGAMLDMLTDRCSTMCLLVNLALLYPGATLFFQISMSLDVASHWLHLHSSVVRGSESHKMIDL 149

  Fly   128 --NFIMRLYY-QKDILTFMCCVNELFYVCLYLLHFTYGPLIFGASLFKILAFLTGPFAVLKALIS 189
              |.::|:|| .:..|..:|..|||||..|||.||:.|||:....||::..::|.|.|:||:|||
Human   150 SGNPVLRIYYTSRPALFTLCAGNELFYCLLYLFHFSEGPLVGSVGLFRMGLWVTAPIALLKSLIS 214

  Fly   190 VMHAYVAGIDLAAVDVRERQERR 212
            |:|...|..::||:|..:|.:::
Human   215 VIHLITAARNMAALDAADRAKKK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
PisNP_573055.1 CDP-OH_P_transf 13..75 CDD:307284 9/10 (90%)
CDIPTXP_005255095.1 CDP-OH_P_transf <85..223 CDD:294308 70/137 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151744
Domainoid 1 1.000 123 1.000 Domainoid score I5627
eggNOG 1 0.900 - - E1_COG0558
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H7159
Inparanoid 1 1.050 209 1.000 Inparanoid score I3690
Isobase 1 0.950 - 0 Normalized mean entropy S852
OMA 1 1.010 - - QHG53925
OrthoDB 1 1.010 - - D1615564at2759
OrthoFinder 1 1.000 - - FOG0004202
OrthoInspector 1 1.000 - - oto88469
orthoMCL 1 0.900 - - OOG6_102569
Panther 1 1.100 - - LDO PTHR15362
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1704
SonicParanoid 1 1.000 - - X2946
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.