DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9240 and Immp2l

DIOPT Version :9

Sequence 1:NP_573054.2 Gene:CG9240 / 32505 FlyBaseID:FBgn0030669 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_444352.2 Gene:Immp2l / 93757 MGIID:2135611 Length:175 Species:Mus musculus


Alignment Length:144 Identity:54/144 - (37%)
Similarity:77/144 - (53%) Gaps:36/144 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 DFVLC----KGPSMEPTLH------SDNVLLTERLSKHWRT----YQPGDIVIAISPIKADQFIC 80
            |.|.|    :|.||:|:|:      ||.|||     .||:.    .|.||||..:||...:|.|.
Mouse    31 DRVACVARVEGSSMQPSLNPGGSQSSDVVLL-----NHWKVRNFEVQRGDIVSLVSPKNPEQKII 90

  Fly    81 KRIVAVSGDQVLIQKPIPIEAEFSGNSDDKKKPVMVKDYVPRGHVWIEGDNKGNSSDSRYYGPIP 145
            ||::|:.||   |.:.|       |:     |..:||  |||||:|:|||:.|:|.||..:||:.
Mouse    91 KRVIALEGD---IVRTI-------GH-----KNRLVK--VPRGHMWVEGDHHGHSFDSNSFGPVS 138

  Fly   146 VGLIRSRVLCRIWP 159
            :||:.:.....:||
Mouse   139 LGLLHAHATHILWP 152

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9240NP_573054.2 sigpep_I_bact 30..159 CDD:274044 52/142 (37%)
S26_SPase_I 31..153 CDD:119398 51/135 (38%)
Peptidase_S24_S26 <81..145 CDD:299172 26/63 (41%)
Immp2lNP_444352.2 sigpep_I_bact 33..152 CDD:274044 51/140 (36%)
S26_SPase_I 36..146 CDD:119398 49/131 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1211147at2759
OrthoFinder 1 1.000 - - FOG0000835
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.