DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9240 and IMP1

DIOPT Version :9

Sequence 1:NP_573054.2 Gene:CG9240 / 32505 FlyBaseID:FBgn0030669 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_013870.1 Gene:IMP1 / 855182 SGDID:S000004758 Length:190 Species:Saccharomyces cerevisiae


Alignment Length:148 Identity:49/148 - (33%)
Similarity:77/148 - (52%) Gaps:13/148 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 YTVAYAAITHCTFEYIGDFVLCKGPSMEPTLHSDN----VLLTERLSKHWRTYQPGDIVIAISPI 73
            |.:......|....|..:|...:|.||.|||.:.|    ||   :..::.|..:.||.::|:.|.
Yeast    15 YAIRSLCFLHIIHMYAYEFTETRGESMLPTLSATNDYVHVL---KNFQNGRGIKMGDCIVALKPT 76

  Fly    74 KADQFICKRIVAVSGDQVLIQKPIPIEAEFSGN--SDDKKKPVMVKDYVPRGHVWIEGDNKGNSS 136
            ..:..||||:..:.||.||:. |..| ..:.|:  .|:::....:|  ||.||||:.|||..:|.
Yeast    77 DPNHRICKRVTGMPGDLVLVD-PSTI-VNYVGDVLVDEERFGTYIK--VPEGHVWVTGDNLSHSL 137

  Fly   137 DSRYYGPIPVGLIRSRVL 154
            |||.|..:|:|||..:::
Yeast   138 DSRTYNALPMGLIMGKIV 155

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9240NP_573054.2 sigpep_I_bact 30..159 CDD:274044 46/131 (35%)
S26_SPase_I 31..153 CDD:119398 46/127 (36%)
Peptidase_S24_S26 <81..145 CDD:299172 25/65 (38%)
IMP1NP_013870.1 sigpep_I_bact 38..155 CDD:274044 45/123 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343942
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41747
Inparanoid 1 1.050 79 1.000 Inparanoid score I1631
Isobase 1 0.950 - 0 Normalized mean entropy S1436
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000835
OrthoInspector 1 1.000 - - oto99270
orthoMCL 1 0.900 - - OOG6_100609
Panther 1 1.100 - - LDO PTHR12383
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R607
SonicParanoid 1 1.000 - - X2521
TreeFam 1 0.960 - -
1413.730

Return to query results.
Submit another query.