DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9240 and AT1G29960

DIOPT Version :9

Sequence 1:NP_573054.2 Gene:CG9240 / 32505 FlyBaseID:FBgn0030669 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_174289.2 Gene:AT1G29960 / 839874 AraportID:AT1G29960 Length:169 Species:Arabidopsis thaliana


Alignment Length:145 Identity:59/145 - (40%)
Similarity:81/145 - (55%) Gaps:19/145 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 HCTFEYIGDFVLCKGPSMEPTLH-SDNVLLTERLSKHWRTYQPGDIVIAISPIKADQFICKRIVA 85
            |.|..|:|......||||.|||| |.||||.||:||.::....||||:..||...::...||::.
plant    31 HVTTNYLGFMAYAYGPSMTPTLHPSGNVLLAERISKRYQKPSRGDIVVIRSPENPNKTPIKRVIG 95

  Fly    86 VSGDQVLIQKPIPIEAEF---SGNSDDKKKPVMVKDYVPRGHVWIEGDNKGNSSDSRYYGPIPVG 147
            :.||.:          .|   |..||:.:..|     ||:|||:::||...||.|||.:|.:|.|
plant    96 IEGDCI----------SFVIDSRKSDESQTIV-----VPKGHVFVQGDYTHNSRDSRNFGTVPYG 145

  Fly   148 LIRSRVLCRIWPISE 162
            ||:.|||.|:||..:
plant   146 LIQGRVLWRVWPFQD 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9240NP_573054.2 sigpep_I_bact 30..159 CDD:274044 53/132 (40%)
S26_SPase_I 31..153 CDD:119398 49/125 (39%)
Peptidase_S24_S26 <81..145 CDD:299172 22/66 (33%)
AT1G29960NP_174289.2 sigpep_I_bact 45..158 CDD:274044 54/127 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 61 1.000 Domainoid score I3811
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 105 1.000 Inparanoid score I2122
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1211147at2759
OrthoFinder 1 1.000 - - FOG0000835
OrthoInspector 1 1.000 - - otm2935
orthoMCL 1 0.900 - - OOG6_100609
Panther 1 1.100 - - O PTHR12383
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2521
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.920

Return to query results.
Submit another query.