DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9240 and PLSP1

DIOPT Version :9

Sequence 1:NP_573054.2 Gene:CG9240 / 32505 FlyBaseID:FBgn0030669 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_189102.3 Gene:PLSP1 / 822055 AraportID:AT3G24590 Length:310 Species:Arabidopsis thaliana


Alignment Length:167 Identity:54/167 - (32%)
Similarity:77/167 - (46%) Gaps:19/167 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 TVAYAAITHCTFEY-IGDFVLCKGPSMEPTLHSDNVLLTERLSKHWRTYQPGDIVIAISP----- 72
            ||..|......|.| |.:.......||.||....:.|:.|::|.::|.....||||..||     
plant   136 TVFVAIAVSLAFRYFIAEPRYIPSLSMYPTFDVGDRLVAEKVSYYFRKPCANDIVIFKSPPVLQE 200

  Fly    73 ---IKADQFICKRIVAVSGDQVLIQKPIPIEAEFSGNSDDKKKPVMVKDY------VPRGHVWIE 128
               ..||.|| |||||..||.|.:...   :...:|.:.::|..:....|      ||...|::.
plant   201 VGYTDADVFI-KRIVAKEGDLVEVHNG---KLMVNGVARNEKFILEPPGYEMTPIRVPENSVFVM 261

  Fly   129 GDNKGNSSDSRYYGPIPVGLIRSRVLCRIWPISEATG 165
            |||:.||.||..:||:|:..|..|.:.|.||.:..:|
plant   262 GDNRNNSYDSHVWGPLPLKNIIGRSVFRYWPPNRVSG 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9240NP_573054.2 sigpep_I_bact 30..159 CDD:274044 45/142 (32%)
S26_SPase_I 31..153 CDD:119398 43/135 (32%)
Peptidase_S24_S26 <81..145 CDD:299172 23/69 (33%)
PLSP1NP_189102.3 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1211147at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100609
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.680

Return to query results.
Submit another query.