DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9240 and AT3G08980

DIOPT Version :9

Sequence 1:NP_573054.2 Gene:CG9240 / 32505 FlyBaseID:FBgn0030669 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001319505.1 Gene:AT3G08980 / 820050 AraportID:AT3G08980 Length:154 Species:Arabidopsis thaliana


Alignment Length:133 Identity:49/133 - (36%)
Similarity:70/133 - (52%) Gaps:30/133 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KGPSMEPTLH-------SDNVLLTERLSKHWRTYQPGDIVIAISPIK-ADQFICKRIVAVSGDQV 91
            :|.||.||.:       .|.||:.:...|.:: :..||:|:..||.. .|::| ||||.:.|   
plant    35 RGDSMSPTFNPQRNSYLDDYVLVDKFCLKDYK-FARGDVVVFSSPTHFGDRYI-KRIVGMPG--- 94

  Fly    92 LIQKPIPIEAEFSGNSDDKKKPVMVKDYVPRGHVWIEGDNKGNSSDSRYYGPIPVGLIRSRVLCR 156
                      |:..:|.|..:       ||.||.|:|||||.:|.|||.:||||:|||:.||...
plant    95 ----------EWISSSRDVIR-------VPEGHCWVEGDNKTSSLDSRSFGPIPLGLIQGRVTRV 142

  Fly   157 IWP 159
            :||
plant   143 MWP 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9240NP_573054.2 sigpep_I_bact 30..159 CDD:274044 47/131 (36%)
S26_SPase_I 31..153 CDD:119398 45/125 (36%)
Peptidase_S24_S26 <81..145 CDD:299172 24/63 (38%)
AT3G08980NP_001319505.1 sigpep_I_bact 30..145 CDD:274044 47/131 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1211147at2759
OrthoFinder 1 1.000 - - FOG0000835
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.