DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9240 and TPP

DIOPT Version :9

Sequence 1:NP_573054.2 Gene:CG9240 / 32505 FlyBaseID:FBgn0030669 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_180603.2 Gene:TPP / 817595 AraportID:AT2G30440 Length:340 Species:Arabidopsis thaliana


Alignment Length:168 Identity:52/168 - (30%)
Similarity:79/168 - (47%) Gaps:20/168 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AYAAITHCTFEYIGDFVLCK-----GPSMEPTLHSDNVLLTERLSKHWRTYQPGDIVIAISP--- 72
            |.||.|..|...:....|.:     ..||.|||...:.::.|::|..:|..:..||||..:|   
plant   157 AKAAFTAVTVSILFRSALAEPKSIPSTSMYPTLDKGDRVMAEKVSYFFRKPEVSDIVIFKAPPIL 221

  Fly    73 --------IKADQFICKRIVAVSGDQVLIQKPIPIEAEFSGNSDDKKKPV---MVKDYVPRGHVW 126
                    ...|.|| |||||..||.|.::.......:.....|...:|:   |...:||:|:|:
plant   222 LEYPEYGYSSNDVFI-KRIVASEGDWVEVRDGKLFVNDIVQEEDFVLEPMSYEMEPMFVPKGYVF 285

  Fly   127 IEGDNKGNSSDSRYYGPIPVGLIRSRVLCRIWPISEAT 164
            :.|||:..|.||..:||:|:..|..|.:.|.||.|:.:
plant   286 VLGDNRNKSFDSHNWGPLPIENIVGRSVFRYWPPSKVS 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9240NP_573054.2 sigpep_I_bact 30..159 CDD:274044 44/147 (30%)
S26_SPase_I 31..153 CDD:119398 42/140 (30%)
Peptidase_S24_S26 <81..145 CDD:299172 23/66 (35%)
TPPNP_180603.2 Peptidase_S26 157..317 CDD:402227 49/160 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1211147at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100609
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.680

Return to query results.
Submit another query.