DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9240 and immp1l

DIOPT Version :9

Sequence 1:NP_573054.2 Gene:CG9240 / 32505 FlyBaseID:FBgn0030669 Length:166 Species:Drosophila melanogaster
Sequence 2:XP_001335263.1 Gene:immp1l / 795154 ZFINID:ZDB-GENE-070522-4 Length:189 Species:Danio rerio


Alignment Length:159 Identity:78/159 - (49%)
Similarity:99/159 - (62%) Gaps:18/159 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKILSRLGRLMRYTVAYAAITHCTFEYIGDFVLCKGPSMEPTLHSDNVLLTERLSKHWRTYQPGD 65
            :|.:|.:|    |||.|..|.||.|||:|:||.|.|||||||:.:.:|:.:||:|:|....|.||
Zfish    32 VKTISFVG----YTVQYGCIAHCAFEYVGEFVSCSGPSMEPTITNHDVVFSERISRHLYRIQKGD 92

  Fly    66 IVIAISPIKADQFICKRIVAVSGDQVLIQKPIPIEAEFSGNSDDKKKPVMVKDYVPRGHVWIEGD 130
            |:||.||......||||::.:.||:|..          ||.||..|    ...||||||||:|||
Zfish    93 IIIAKSPSNPKMNICKRVIGLEGDKVCT----------SGPSDIFK----THTYVPRGHVWLEGD 143

  Fly   131 NKGNSSDSRYYGPIPVGLIRSRVLCRIWP 159
            |..||:|||.|||||..|||.||..::||
Zfish   144 NLRNSTDSRSYGPIPYALIRGRVCLKLWP 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9240NP_573054.2 sigpep_I_bact 30..159 CDD:274044 62/128 (48%)
S26_SPase_I 31..153 CDD:119398 60/121 (50%)
Peptidase_S24_S26 <81..145 CDD:299172 30/63 (48%)
immp1lXP_001335263.1 sigpep_I_bact 54..172 CDD:274044 64/131 (49%)
S26_SPase_I 57..166 CDD:119398 60/122 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170581458
Domainoid 1 1.000 70 1.000 Domainoid score I9537
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41747
Inparanoid 1 1.050 151 1.000 Inparanoid score I4337
OMA 1 1.010 - - QHG58972
OrthoDB 1 1.010 - - D1211147at2759
OrthoFinder 1 1.000 - - FOG0000835
OrthoInspector 1 1.000 - - oto40491
orthoMCL 1 0.900 - - OOG6_100609
Panther 1 1.100 - - LDO PTHR12383
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R607
SonicParanoid 1 1.000 - - X2521
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.