DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9240 and immp1l

DIOPT Version :9

Sequence 1:NP_573054.2 Gene:CG9240 / 32505 FlyBaseID:FBgn0030669 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001016589.1 Gene:immp1l / 549343 XenbaseID:XB-GENE-5806212 Length:167 Species:Xenopus tropicalis


Alignment Length:159 Identity:70/159 - (44%)
Similarity:100/159 - (62%) Gaps:14/159 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KILSRLGRLMRYTVAYAAITHCTFEYIGDFVLCKGPSMEPTLHSDNVLLTERLSKHWRTYQPGDI 66
            :|:.:...|:.||:.|..|.||.|||||:.|:|.|||||||:.:.:|||.:.||:|:.:...|||
 Frog     4 RIVGKTLGLLGYTIQYGCIAHCAFEYIGEVVICSGPSMEPTIRNYDVLLCDNLSRHFFSIHKGDI 68

  Fly    67 VIAISPIKADQFICKRIVAVSGDQVLIQKPIPIEAEFSGNSDDKKKPVMVKDYVPRGHVWIEGDN 131
            ::|.||.|....||||::.:.||:|.:..|..:....:              |||:||||:||||
 Frog    69 IVAKSPDKPSVNICKRVIGLEGDKVCMSSPSALLKRHT--------------YVPKGHVWLEGDN 119

  Fly   132 KGNSSDSRYYGPIPVGLIRSRVLCRIWPI 160
            ..||:|||.|||:|..|||.|:..|:||:
 Frog   120 LDNSTDSRSYGPVPYALIRGRICLRVWPL 148

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9240NP_573054.2 sigpep_I_bact 30..159 CDD:274044 55/128 (43%)
S26_SPase_I 31..153 CDD:119398 53/121 (44%)
Peptidase_S24_S26 <81..145 CDD:299172 25/63 (40%)
immp1lNP_001016589.1 S26_SPase_I 32..141 CDD:119398 53/122 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 1.000 Domainoid score I9310
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H41747
Inparanoid 1 1.050 153 1.000 Inparanoid score I4230
OMA 1 1.010 - - QHG58972
OrthoDB 1 1.010 - - D1211147at2759
OrthoFinder 1 1.000 - - FOG0000835
OrthoInspector 1 1.000 - - oto102998
Panther 1 1.100 - - LDO PTHR12383
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R607
SonicParanoid 1 1.000 - - X2521
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1212.110

Return to query results.
Submit another query.