DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9240 and immp2l

DIOPT Version :9

Sequence 1:NP_573054.2 Gene:CG9240 / 32505 FlyBaseID:FBgn0030669 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001003755.1 Gene:immp2l / 445299 ZFINID:ZDB-GENE-040808-9 Length:183 Species:Danio rerio


Alignment Length:170 Identity:53/170 - (31%)
Similarity:79/170 - (46%) Gaps:29/170 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LSRLGRLMRYTVAYAA-------ITHCTFEYIGDFVLCKGPSMEPTLHSD-----NVLLTERLSK 56
            :::.|...||..|:.:       :|....:.:......:|.||:|:|:.|     :|:|..|.|.
Zfish     1 MAQTGFGRRYFKAFVSGFFVAVPVTVTVLDRLAYVARVEGASMQPSLNPDGESSPDVVLLNRWSV 65

  Fly    57 HWRTYQPGDIVIAISPIKADQFICKRIVAVSGDQVLIQKPIPIEAEFSGNSDDKKKPVMVKDYVP 121
            .....|.||||..:||....|.|.||::.:.||             |......|.:.|.    ||
Zfish    66 RNYHVQRGDIVSVLSPKNPQQKIIKRVIGIEGD-------------FIKTLGYKNRYVR----VP 113

  Fly   122 RGHVWIEGDNKGNSSDSRYYGPIPVGLIRSRVLCRIWPIS 161
            .||:|||||:.|:|.||..:||:.:||:..|....|||.|
Zfish   114 DGHLWIEGDHHGHSFDSNAFGPVSLGLVHGRASHIIWPPS 153

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9240NP_573054.2 sigpep_I_bact 30..159 CDD:274044 45/133 (34%)
S26_SPase_I 31..153 CDD:119398 43/126 (34%)
Peptidase_S24_S26 <81..145 CDD:299172 22/63 (35%)
immp2lNP_001003755.1 sigpep_I_bact 32..153 CDD:274044 47/137 (34%)
S26_SPase_I 35..145 CDD:119398 43/126 (34%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 161..183
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1211147at2759
OrthoFinder 1 1.000 - - FOG0000835
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.