DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9240 and twr

DIOPT Version :9

Sequence 1:NP_573054.2 Gene:CG9240 / 32505 FlyBaseID:FBgn0030669 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_649676.1 Gene:twr / 40815 FlyBaseID:FBgn0262801 Length:185 Species:Drosophila melanogaster


Alignment Length:167 Identity:34/167 - (20%)
Similarity:54/167 - (32%) Gaps:66/167 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EYIGDFVLCKGPSMEPTLHSDNVLLTERLSKHWRTYQPGDIVIAISPIKADQFICKRIVAVSGDQ 90
            |.:|||                    .|::|....||.....:.:|   :...|.|.::.|:|.:
  Fly    11 EMLGDF--------------------NRMNKRQSLYQVLSFAMIVS---SALMIWKGLMVVTGSE 52

  Fly    91 VLIQKPIPIEAEFSGNSDD-------------KKKPVMVKDYV---------PRGHVWI------ 127
                  .||....||:.:.             |::||.|.:.|         |..|..|      
  Fly    53 ------SPIVVVLSGSMEPAFHRGDLLFLTNYKEEPVRVGEIVVFKVEGRDIPIVHRVIKLHEKE 111

  Fly   128 --------EGDNKGNSSDSRYYGPIPVGLIRSRVLCR 156
                    :||| .|..|...|.|..:.|.:..::.|
  Fly   112 DGSVKFLTKGDN-NNVDDRGLYAPNQLWLTKKDIVGR 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9240NP_573054.2 sigpep_I_bact 30..159 CDD:274044 32/163 (20%)
S26_SPase_I 31..153 CDD:119398 30/157 (19%)
Peptidase_S24_S26 <81..145 CDD:299172 22/99 (22%)
twrNP_649676.1 Peptidase_S24_S26 28..181 CDD:415851 26/130 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.