DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9240 and AT1G23465

DIOPT Version :9

Sequence 1:NP_573054.2 Gene:CG9240 / 32505 FlyBaseID:FBgn0030669 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_001319068.1 Gene:AT1G23465 / 2745760 AraportID:AT1G23465 Length:169 Species:Arabidopsis thaliana


Alignment Length:143 Identity:60/143 - (41%)
Similarity:83/143 - (58%) Gaps:15/143 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 HCTFEYIGDFVLCKGPSMEPTLH-SDNVLLTERLSKHWRTYQPGDIVIAISPIKADQFICKRIVA 85
            |.|..|:|......||||.|||| |.|:||.||:||.::....||||:..||...::...||:|.
plant    31 HVTTNYLGFMAYAYGPSMIPTLHPSGNMLLAERISKRYQKPSRGDIVVIRSPENPNKTPIKRVVG 95

  Fly    86 VSGDQV-LIQKPIPIEAEFSGNSDDKKKPVMVKDYVPRGHVWIEGDNKGNSSDSRYYGPIPVGLI 149
            |.||.: .:..|:        .||:.:..|     ||:|||:::||...||.|||.:||:|.|||
plant    96 VEGDCISFVIDPV--------KSDESQTIV-----VPKGHVFVQGDYTHNSRDSRNFGPVPYGLI 147

  Fly   150 RSRVLCRIWPISE 162
            :.|||.|:||..:
plant   148 QGRVLWRVWPFQD 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9240NP_573054.2 sigpep_I_bact 30..159 CDD:274044 54/130 (42%)
S26_SPase_I 31..153 CDD:119398 50/123 (41%)
Peptidase_S24_S26 <81..145 CDD:299172 24/64 (38%)
AT1G23465NP_001319068.1 sigpep_I_bact 45..158 CDD:274044 55/125 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 53 1.000 Domainoid score I4207
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 105 1.000 Inparanoid score I2122
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1211147at2759
OrthoFinder 1 1.000 - - FOG0000835
OrthoInspector 1 1.000 - - otm2935
orthoMCL 1 0.900 - - OOG6_100609
Panther 1 1.100 - - O PTHR12383
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X2521
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.