DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9240 and Sec11c

DIOPT Version :9

Sequence 1:NP_573054.2 Gene:CG9240 / 32505 FlyBaseID:FBgn0030669 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_705892.1 Gene:Sec11c / 266758 RGDID:628665 Length:192 Species:Rattus norvegicus


Alignment Length:122 Identity:28/122 - (22%)
Similarity:49/122 - (40%) Gaps:35/122 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 SMEPTLHSDNVLLTERLSKHWRTYQPGDIVIAISPIKADQFICKRIVAVSG-DQVLIQKPIPIEA 101
            ||||..|..::|......:              .||:|.:.:   :..|.| |..::.:.|.:..
  Rat    68 SMEPAFHRGDLLFLTNFRE--------------DPIRAGEIV---VFKVEGRDIPIVHRVIKVHE 115

  Fly   102 EFSGN------SDDKKKPVMVKDYVPRGHVWIEGDNKGNSSD--SRYYGPIP-VGLI 149
            :.:|:      .|:.:    |.|   || ::.||.|.....|  .|..|.:| ||::
  Rat   116 KDNGDIKFLTKGDNNE----VDD---RG-LYKEGQNWLEKKDVVGRARGFLPYVGMV 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9240NP_573054.2 sigpep_I_bact 30..159 CDD:274044 28/122 (23%)
S26_SPase_I 31..153 CDD:119398 28/122 (23%)
Peptidase_S24_S26 <81..145 CDD:299172 16/72 (22%)
Sec11cNP_705892.1 Peptidase_S24_S26 34..167 CDD:299172 28/122 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.