DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG9240 and SPBC336.13c

DIOPT Version :9

Sequence 1:NP_573054.2 Gene:CG9240 / 32505 FlyBaseID:FBgn0030669 Length:166 Species:Drosophila melanogaster
Sequence 2:NP_596133.1 Gene:SPBC336.13c / 2540235 PomBaseID:SPBC336.13c Length:180 Species:Schizosaccharomyces pombe


Alignment Length:132 Identity:45/132 - (34%)
Similarity:72/132 - (54%) Gaps:19/132 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 KGPSMEPTLHSD-NVLLTER--LSKHWRTYQPGDIVIAISPIKADQFICKRIVAVSGDQVLIQKP 96
            :|.||:|..:.: |:|..:|  |.|..:.|:.||:||..||...::.:.||::.|..|.:..:.|
pombe    43 EGRSMKPAFNPETNMLQRDRVLLWKWNKDYKRGDVVILRSPENPEELLVKRVLGVEYDIMKTRPP 107

  Fly    97 IPIEAEFSGNSDDKKKPVMVKDYVPRGHVWIEGDNKGNSSDSRYYGPIPVGLIRSRVLCRIWPIS 161
                          ||..:|.  ||.||||:|||.:.:|.||..:||:..|||.::|:..::|.|
pombe   108 --------------KKLSLVP--VPEGHVWVEGDEQFHSIDSNKFGPVSTGLITAKVIAILFPFS 156

  Fly   162 EA 163
            .|
pombe   157 RA 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG9240NP_573054.2 sigpep_I_bact 30..159 CDD:274044 42/126 (33%)
S26_SPase_I 31..153 CDD:119398 41/120 (34%)
Peptidase_S24_S26 <81..145 CDD:299172 22/63 (35%)
SPBC336.13cNP_596133.1 sigpep_I_bact 36..156 CDD:274044 43/128 (34%)
S26_SPase_I 38..148 CDD:119398 41/120 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0681
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000835
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.