DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8128 and NUDX1

DIOPT Version :10

Sequence 1:NP_573053.2 Gene:CG8128 / 32504 FlyBaseID:FBgn0030668 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_177044.1 Gene:NUDX1 / 843207 AraportID:AT1G68760 Length:147 Species:Arabidopsis thaliana


Alignment Length:91 Identity:25/91 - (27%)
Similarity:48/91 - (52%) Gaps:10/91 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   176 LVVSDRFAMIPNS-WKLPGGYVEPRENLIDAAIREVAEETGIRTEFRSVVSLRHAHGGTFGCSDM 239
            :::..|.:.|.|| :.||||::|..|:..:.|.|||.||||::.|...::::.:...........
plant    22 ILLGRRRSSIGNSTFALPGGHLEFGESFEECAAREVMEETGLKIEKMKLLTVTNNVFKEAPTPSH 86

  Fly   240 YVVIALK---------PLNLDFTRCE 256
            ||.::::         |.|::..:||
plant    87 YVSVSIRAVLVDPSQEPKNMEPEKCE 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8128NP_573053.2 Nudix_hydro 67..146 CDD:465697
NUDIX_ASFGF2_Nudt6 159..290 CDD:467554 25/91 (27%)
NUDX1NP_177044.1 PLN02325 1..144 CDD:215184 25/91 (27%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.