DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8128 and NUDT10

DIOPT Version :9

Sequence 1:NP_001285282.1 Gene:CG8128 / 32504 FlyBaseID:FBgn0030668 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001329748.1 Gene:NUDT10 / 828648 AraportID:AT4G25434 Length:309 Species:Arabidopsis thaliana


Alignment Length:299 Identity:76/299 - (25%)
Similarity:132/299 - (44%) Gaps:49/299 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 DVFRGITDRFAGVTVDGREENVDKSSFRDKLTKSLDFWTTNKNRAIWFRVYKEQADWVPILAENG 129
            :|...:.|.:.||.|: .:..:|..:|...|..|.:.|.....:.:|..:.....:.|....:.|
plant    18 EVLPFVDDDYGGVIVE-MKTPMDTKNFVAALRDSFEQWRLQGKKGVWLNLPLSHVNLVEPAVKEG 81

  Fly   130 FDFHHAKTGVVVMYRWLPEHESSNLPTYAHTLMGVGGLVINEQDEVLVVSDRFAMIPNS--WKLP 192
            |.:|||:...:::..|:||.||: :|..|...:.||.:|:|...|:|||.:::..:..|  ||:|
plant    82 FRYHHAEPTYLMLVYWIPEAEST-IPLNASHRVRVGAVVLNHNKEILVVQEKYGSLCGSGIWKIP 145

  Fly   193 GGYVEPRENLIDAAIREVAEETGIR---------------------------TEFRSVVSLRHAH 230
            .|.|:..|.:..||||||.||||:|                           |||..:::....|
plant   146 TGVVDEGEEIFAAAIREVKEETGVRRSIYLNVNQSTINIYNLTFSYIYLQIDTEFLEILAFCQTH 210

  Fly   231 GGTFGCSDMYVVIALKPLNLDFTRCEREIARIQWMPIAEYLKHPQVHETNR----QFVC------ 285
            ...|..||::.|..|:|.:.|..:.:.||...|||...:....|..|:.:.    ..:|      
plant   211 ESFFAKSDLFFVCLLRPTSFDIQKQDLEIEAAQWMRFEDSASQPITHKNDLFKDIHHICSMKMEK 275

  Fly   286 TFLDYQKRGLTLTCRDEVHQVLKKKYNLYYVDREQPQEQ 324
            ::..:.|:.:|....|        |....|:::::..||
plant   276 SYSGFSKKPITTFFDD--------KLGYLYLNKQEDMEQ 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8128NP_001285282.1 Nudix_Hydrolase_12 159..287 CDD:240027 45/166 (27%)
NUDT10NP_001329748.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 101 1.000 Domainoid score I2320
eggNOG 1 0.900 - - E1_KOG0648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 164 1.000 Inparanoid score I1600
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D835461at2759
OrthoFinder 1 1.000 - - FOG0002753
OrthoInspector 1 1.000 - - otm2529
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR13994
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1840
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.930

Return to query results.
Submit another query.