DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8128 and NUDT7

DIOPT Version :9

Sequence 1:NP_001285282.1 Gene:CG8128 / 32504 FlyBaseID:FBgn0030668 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_001190707.1 Gene:NUDT7 / 826884 AraportID:AT4G12720 Length:322 Species:Arabidopsis thaliana


Alignment Length:286 Identity:81/286 - (28%)
Similarity:120/286 - (41%) Gaps:62/286 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VFRGITDRFAGVTVDGREENVDKSSFRDKLTKSLDFWTTNKNRAIWFRVYKEQADWVPILAENGF 130
            :..|.||.:.||||. ..|.:|...|.:.|..||..|.....:.||.::....|:.|......||
plant    10 LLEGETDNYDGVTVT-MVEPMDSEVFTESLRASLSHWREEGKKGIWIKLPLGLANLVEAAVSEGF 73

  Fly   131 DFHHAKTGVVVMYRWLPEHESSNLPTYAHTLMGVGGLVINEQ-DEVLVVSDR--FAMIPNSWKLP 192
            .:|||:...:::..|:.| ....:|..|..::|.|.||||:. .|||||.:|  |....|.||||
plant    74 RYHHAEPEYLMLVSWISE-TPDTIPANASHVVGAGALVINKNTKEVLVVQERSGFFKDKNVWKLP 137

  Fly   193 GGYVEPR----------------------------------------ENLIDAAIREVAEETGIR 217
            .|.:...                                        |::.....|||.|||||.
plant   138 TGVINEELVVLRVVGELHKKVVLTSYRSIKCLLIICNDTKNETKRMGEDIWTGVAREVEEETGII 202

  Fly   218 TEFRSVVSLRHAHGGTF-GCSDMYVVIALKPLNLDFTRCEREIARIQWMPIAEYLKHPQVHETNR 281
            .:|..|::.|.:|.... ..:||:.:..|.|.:.|.|..:.||.:.:||||.||:..|. ::.|.
plant   203 ADFVEVLAFRQSHKAILKKKTDMFFLCVLSPRSYDITEQKSEILQAKWMPIQEYVDQPW-NKKNE 266

  Fly   282 QF-----VCTFLDYQKRGLTLTCRDE 302
            .|     :|     ||:     |.:|
plant   267 MFKFMANIC-----QKK-----CEEE 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8128NP_001285282.1 Nudix_Hydrolase_12 159..287 CDD:240027 50/176 (28%)
NUDT7NP_001190707.1 Nudix_Hydrolase 102..275 CDD:294304 49/173 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 101 1.000 Domainoid score I2320
eggNOG 1 0.900 - - E1_KOG0648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 164 1.000 Inparanoid score I1600
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D835461at2759
OrthoFinder 1 1.000 - - FOG0002753
OrthoInspector 1 1.000 - - otm2529
orthoMCL 1 0.900 - - OOG6_103452
Panther 1 1.100 - - O PTHR13994
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1840
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.