DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8128 and NUDX23

DIOPT Version :10

Sequence 1:NP_573053.2 Gene:CG8128 / 32504 FlyBaseID:FBgn0030668 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_565965.1 Gene:NUDX23 / 818807 AraportID:AT2G42070 Length:280 Species:Arabidopsis thaliana


Alignment Length:95 Identity:29/95 - (30%)
Similarity:39/95 - (41%) Gaps:16/95 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   164 VGGLVINEQDEVLVVSDRFAMIPNSWKLPGGYVEPRENLIDAAIREVAEETGIRTEFRSVVSLRH 228
            |.|.:|..:.:||:...........|.||.||:|..|:....|:||..||.|...|   |:|   
plant   124 VVGCLIEHEGKVLLCKRNIQPSHGLWTLPAGYLEVGESAAQGAMRETWEEAGATVE---VIS--- 182

  Fly   229 AHGGTFGCSDM------YVVIALKPLNLDF 252
                .|...|:      ||:...|..||.|
plant   183 ----PFAQLDIPLIGQTYVIFLAKLKNLHF 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8128NP_573053.2 Nudix_hydro 67..146 CDD:465697
NUDIX_ASFGF2_Nudt6 159..290 CDD:467554 29/95 (31%)
NUDX23NP_565965.1 Nudix_N_2 86..116 CDD:464323
NUDIX_Hydrolase 121..243 CDD:467545 29/95 (31%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.