DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8128 and NUDT6

DIOPT Version :9

Sequence 1:NP_001285282.1 Gene:CG8128 / 32504 FlyBaseID:FBgn0030668 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_178526.1 Gene:NUDT6 / 814985 AraportID:AT2G04450 Length:283 Species:Arabidopsis thaliana


Alignment Length:223 Identity:74/223 - (33%)
Similarity:117/223 - (52%) Gaps:16/223 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 DTPADVFRGITDRFAGVTVDGREENVDKSSFRDKLTKSLDFWTTNKNRAIWFRVYKEQADWV--- 122
            |..:.:.:|:.|.:.||.|: ..|.:....|..||..||.:|:....:.||.::    ||.:   
plant     5 DQESLLLQGVPDNYGGVKVN-LTEPMTIEDFVPKLRASLVYWSNQGTKGIWLKL----ADGLDNL 64

  Fly   123 --PILAENGFDFHHAKTGVVVMYRWLPEHESSNLPTYAHTLMGVGGLVINEQ-DEVLVVSDRFAM 184
              |..|| ||..|||:....::..|:.: ..|.||..|...:|||..|:|:: .|||||.:....
plant    65 IAPAKAE-GFVCHHAEREYTMLTSWIAD-VPSTLPANASHRIGVGAFVLNKKTKEVLVVQEIDGH 127

  Fly   185 IPNS--WKLPGGYVEPRENLIDAAIREVAEETGIRTEFRSVVSLRHAHGGTFGC-SDMYVVIALK 246
            ...:  ||||.|.|:..||:.:.|:|||.|||||:|:|..|::.|.:|...... :|::.:..|:
plant   128 FKGTGVWKLPTGVVKEGENIWEGALREVEEETGIKTKFVEVLAFRESHQAFLEIKTDIFFLCELE 192

  Fly   247 PLNLDFTRCEREIARIQWMPIAEYLKHP 274
            |...:..:.:.||...:||||.||:..|
plant   193 PTTFEIKKQDSEILAAKWMPIEEYVNQP 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8128NP_001285282.1 Nudix_Hydrolase_12 159..287 CDD:240027 44/120 (37%)
NUDT6NP_178526.1 Nudix_hydro 11..89 CDD:375717 24/83 (29%)
Nudix_Hydrolase_12 102..235 CDD:240027 44/119 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 101 1.000 Domainoid score I2320
eggNOG 1 0.900 - - E1_KOG0648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 164 1.000 Inparanoid score I1600
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D835461at2759
OrthoFinder 1 1.000 - - FOG0002753
OrthoInspector 1 1.000 - - otm2529
orthoMCL 1 0.900 - - OOG6_103452
Panther 1 1.100 - - O PTHR13994
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1840
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1211.830

Return to query results.
Submit another query.