DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8128 and NUDT5

DIOPT Version :9

Sequence 1:NP_001285282.1 Gene:CG8128 / 32504 FlyBaseID:FBgn0030668 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_178524.2 Gene:NUDT5 / 814983 AraportID:AT2G04430 Length:302 Species:Arabidopsis thaliana


Alignment Length:254 Identity:81/254 - (31%)
Similarity:124/254 - (48%) Gaps:15/254 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 TMDTPA---DVFRGITDRFAGVTVDGRE-ENVDKSSFRDKLTKSLDFWTTNKNRAIWFRVYKEQA 119
            :||..|   .:..|..|||.|..|:..| |::....|..||..||..|.....:.||.::..|.:
plant    19 SMDGEAFEISLLDGEEDRFGGTVVNLMEVESMTIGDFDSKLDVSLKAWKDQGKKGIWIKLPSELS 83

  Fly   120 DWVPILAENGFDFHHAKTGVVVMYRWLPEHESSNLPTYAHTLMGVGGLVINEQDEVLVVSDR--F 182
            ..|....:.||.:|||:...|::..|||| ..|.||..|...:|:|..|:|:..|:|||.:.  :
plant    84 SLVDTAIKKGFTYHHAENEYVMLTFWLPE-PPSTLPCNASHRIGIGAFVLNKNGEMLVVQENSGY 147

  Fly   183 AMIPNSWKLPGGYVEPRENLIDAAIREVAEETGIRTEFRSVVSLRHAHGGTF-GCSDMYVVIALK 246
            ....|.||:|.|.::..|::...|:|||.|||.|..||..|:|...:|...: ..:|::.|..|:
plant   148 FKDKNVWKVPTGTIKEGESIWAGAVREVKEETDIDAEFVEVLSFMESHQAVWQRKTDIFFVCELE 212

  Fly   247 PLNLDFTRCEREIARIQWMPIAEYLKHPQVH-ETNRQF-----VCTFLDYQK-RGLTLT 298
            ....:..:.:.||...:|||:.||:..|..: |.|..|     :|.....:| .|..||
plant   213 ARTFEIQKQDSEIHAAKWMPVEEYVNQPYHNKEGNEMFKLIANICLKRSREKYTGFVLT 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8128NP_001285282.1 Nudix_Hydrolase_12 159..287 CDD:240027 42/136 (31%)
NUDT5NP_178524.2 Nudix_Hydrolase 123..257 CDD:294304 41/133 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 101 1.000 Domainoid score I2320
eggNOG 1 0.900 - - E1_KOG0648
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 164 1.000 Inparanoid score I1600
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D835461at2759
OrthoFinder 1 1.000 - - FOG0002753
OrthoInspector 1 1.000 - - otm2529
orthoMCL 1 0.900 - - OOG6_103452
Panther 1 1.100 - - O PTHR13994
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1840
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1110.830

Return to query results.
Submit another query.