DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG8128 and CG10898

DIOPT Version :9

Sequence 1:NP_001285282.1 Gene:CG8128 / 32504 FlyBaseID:FBgn0030668 Length:330 Species:Drosophila melanogaster
Sequence 2:NP_650083.1 Gene:CG10898 / 41384 FlyBaseID:FBgn0037911 Length:340 Species:Drosophila melanogaster


Alignment Length:151 Identity:39/151 - (25%)
Similarity:63/151 - (41%) Gaps:33/151 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 VDKSSFRDKLTKSLDFWTTNKNRAIWFRVYK--EQADWVPILAENGFDFHHAKTGVVVMYRWLPE 148
            :|.....|..|:..||....:|.....:..:  ..:|:||||.:.                    
  Fly    12 LDSKDLGDITTELCDFSLKEQNATAEAQGVQPSSASDFVPILGQT-------------------- 56

  Fly   149 HESSNLPTYAHTLMGVGGLVINEQDEVLVVSDRFAMIPNSWKLPGGYVEPRENLIDAAIREVAEE 213
                  .||.     |..::|||.||:|::.:........|.||.|.:|..|::.:||.|||.||
  Fly    57 ------VTYI-----VACVLINEHDELLMIEEAKQSCAGKWYLPAGRMERGESITEAAAREVFEE 110

  Fly   214 TGIRTEFRSVVSLRHAHGGTF 234
            ||:..|..:::::..|.|..|
  Fly   111 TGLNAELTTLLAVEAAGGSWF 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG8128NP_001285282.1 Nudix_Hydrolase_12 159..287 CDD:240027 26/76 (34%)
CG10898NP_650083.1 Nudix_Hydrolase_13 59..180 CDD:240028 27/78 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0648
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.